KEGG   Folsomia candida: 110843754Help
Entry
110843754         CDS       T05043                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fcd  Folsomia candida
Brite
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     110843754
Peptidases [BR:fcd01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   110843754
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110843754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 404 aa AA seqDB search
MAKEVTSITINYRDIIRVLRIITLVLLLLTAGIVSFVLVYYGIFSLGGYIGCLLLLILLT
YLVLPVIFCFCPHLHQSMVFQPHVDAAGIDFEKPQDLRGVRNFKISDGTIGVWHILPSSL
SDKSENQEASFWQDAVRAKGHNGVIVYFHGVTGTRGKWHRKELYKVLQDKEHHIISCDYR
GFGDSTKVKRITESGVVDDALAVYQFVRQELLGGDTRIPVFIWGHSLGAGISSHAVAKLS
DLITLPCPNGLVLESPFDNFGEELRNHAKLKIWRLLPFFDRLFVNPLRKSDIAFQNDHHI
SKISVPIMIMHAKDDNVVPSHLGKRLFEAGRYRPNDFNPLYFVHMKAGKHNEMYKLNAEF
GKIITLFTDACMHACIPITNLNLNRNSCWHHDCSVDAEIVCSHC
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaagtaacttcaattacgataaactatcgtgacattatcagagtactacga
atcattacattagttttgctcttgctgactgctggaatagtgtcctttgttcttgtatat
tatggaatattttctttagggggctatatcggatgtctgctgttgctcattttactaaca
tatctagttttaccagttattttttgtttttgtcctcatcttcaccagtccatggttttc
caaccgcatgtggatgctgctggaattgactttgagaaacctcaagacttgagaggggtc
cgtaattttaagatatcggacggtacaataggtgtatggcatattctaccctccagctta
tccgacaagtctgaaaaccaagaagcgtctttttggcaagatgcagtgagagcaaaggga
cacaacggggtaatagtttactttcacggcgttacaggcactagaggaaaatggcaccga
aaggaactttacaaagtcttacaagacaaggagcaccatatcattagctgtgattatcgt
ggatttggagactcgaccaaggtgaaaagaataacggaaagtggcgtcgtcgatgacgct
ctcgcagtttatcaattcgttcggcaagaattgctgggaggagatacgcgaattcctgta
ttcatttggggtcactcactgggtgctggaatttcatcacacgcagtagcaaaattatcg
gatctcattactcttccatgtccaaatggactagtgttggaatcgccattcgacaacttt
ggtgaagaacttagaaaccatgctaaattaaagatttggaggcttcttccattctttgat
cgtttatttgtcaacccattgagaaaaagtgatatagcattccaaaatgatcaccacatt
tctaaaatttcggtcccaattatgataatgcatgcaaaagatgacaacgttgttcccagt
catttaggaaagcggttgtttgaagcaggacgataccgacccaatgatttcaatccatta
tattttgttcacatgaaggctggcaaacataatgaaatgtacaaactgaatgcagagttt
gggaagattattactttatttaccgatgcatgcatgcatgcatgcattccgataaccaac
ctgaacttgaacagaaattcttgttggcatcatgattgctcggttgatgctgaaattgtg
tgcagtcactgctag

DBGET integrated database retrieval system