KEGG   Francisella cf. novicida Fx1: FNFX1_0023Help
Entry
FNFX1_0023        CDS       T01937                                 

Definition
hypothetical protein (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fcf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fcf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(17837..18763)
Genome map
AA seq 308 aa AA seqDB search
MLSFQKLLRGDQITKDDLFKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGSSSSTQKGETLDDTGRMIDQYADIIVMRHPKPHSVEEFSKYV
NSPVINAGDGENEHPTQSLVDLYTIYSEKATLDNLKVGFLGDLKYGRTVHSLTNILAKYN
ASFKFISSKELQIPKKLKDFIIKNGNSFIELDKVSTDVLEDLDVLYVTRVQRERFPDEES
YLKNKDLCYLDRKHISPRSNFIILHPLPRVDEMDRSIDELECAKYFEQIKYSIPIRMALL
VLLVNPKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagttactacgcggtgatcaaattactaaagatgacttgtttaaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagagcctatcaaagat
ttagaaggcaaaatattagcatctcttttctttgaaccaagcactagaactagattctct
tttgagtcggctatgaatagacttggtggtaaagtaatatcactagaaaatggctcatca
agctcaacacaaaaaggcgaaacccttgatgacacaggtagaatgatcgatcaatatgct
gacattattgtgatgcgtcaccctaaaccacatagtgttgaagagttctctaaatatgtc
aactctcctgtgataaatgctggagatggtgaaaatgaacaccctacccaatctcttgta
gatttatatactatctactctgagaaagccacccttgataatctaaaagttggtttctta
ggagatctaaaatatggtcgtacggttcactcactaaccaatatccttgctaaatataac
gcctcgtttaaatttatatcttcaaaagagctacagattcctaaaaaactaaaagatttt
atcatcaaaaatggcaactcttttattgagttagataaagttagtaccgatgttttagaa
gacttagatgtactatatgtaactcgcgtccagagagaaaggtttcctgatgaagaaagc
tatctaaaaaataaagatttatgctatttagatagaaagcatatttcccctagaagtaat
tttataattcttcatcctctacctagagttgatgagatggatagatctattgatgagctt
gagtgtgcgaaatattttgagcaaatcaaatatagtattcctatcagaatggcgctattg
gttttattagtaaatcctaaaaaataa

DBGET integrated database retrieval system