KEGG   Francisella cf. novicida Fx1: FNFX1_0141Help
Entry
FNFX1_0141        CDS       T01937                                 

Definition
hypothetical protein (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FNFX1_0141
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     FNFX1_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138444..139271
Genome map
AA seq 275 aa AA seqDB search
MANIKAKKYYSYAKINLFLHILNKRTDGYHNLQTWFTFLGLKDQLTFSFNNSREINISSN
ISIAAKQDNLVYKAIKKFQQSYRVQDIGVDIEIKKNIPMGAGLGGGSSNAATTLIALRDY
YLPQLSNEEMIPLAAKLGADVPIFVYGKSAWAEGIGEILYHKDFSPQYALLIKPDIHIST
KEFFSSEDLINSSVLISKDLGFDKSIMHNDFENVFYAKYPGFSQYLKELDSDFRMTGTGS
CFYLLSADKNKLEQLARKINKPLDKWLVKTLNYVY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaagctaaaaaatactatagttatgcaaagataaatctatttttgcat
atattaaacaaacgtacagatggttaccataatttacagacttggtttacctttttgggc
ttaaaagatcaactaacttttagttttaataattcacgagaaattaatatttcgagtaat
attagtattgctgcaaaacaagataatttagtatataaggctatcaaaaaatttcagcaa
agctatagagtacaagatataggtgttgatattgaaattaagaaaaatattccaatggga
gcaggacttggcggtggaagctcaaatgccgctactacacttatagctttacgtgattat
tatttgccgcagttgtcaaatgaggagatgattccattagcagcaaaactcggtgccgat
gtaccgatatttgtttatggtaaatctgcatgggcagaaggtataggtgagatattatac
cataaggattttagtccacagtatgcattattgattaaaccggatatccatattagtaca
aaagagtttttttcaagtgaggatttaattaattcatcggttctaatatctaaagattta
ggctttgataagagcattatgcataacgattttgagaatgttttttatgcaaaatatcca
gggtttagtcaatatctaaaagagctagatagtgattttagaatgacaggtacaggttct
tgtttttatttactctcagcagataaaaataaacttgagcaacttgcaagaaaaattaat
aaacctcttgacaaatggctagtcaaaacattaaactatgtctactaa

DBGET integrated database retrieval system