KEGG   Francisella cf. novicida Fx1: FNFX1_0213Help
Entry
FNFX1_0213        CDS       T01937                                 

Definition
hypothetical protein (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FNFX1_0213
   00240 Pyrimidine metabolism
    FNFX1_0213
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FNFX1_0213
   03430 Mismatch repair
    FNFX1_0213
   03440 Homologous recombination
    FNFX1_0213
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FNFX1_0213
DNA replication proteins [BR:fcf03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FNFX1_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211074..211511
Genome map
AA seq 145 aa AA seqDB search
MKIEFKVLQTQDINQMLEVLITEVVKEYALQKTIAILAPAGIAKQLDDKLWQDGQDSFIP
HHCAINAREYNQYNNIPILITDNLFIASGYDVLINIMDVAVDPQRVKVKELKEFVYQQDS
ALQASRKKYVYYKKSNLEIITVQAN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtgctg
attactgaagttgtcaaagaatatgctttacaaaagacaatcgcaattttagcacctgca
ggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatccca
catcattgtgctataaatgctagagagtataatcaatataataatattccaattcttatc
acagataatttatttattgcctcaggttatgatgttttaattaatattatggatgtggct
gtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagatagc
gctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagataatt
actgttcaagctaactaa

DBGET integrated database retrieval system