KEGG   Francisella cf. novicida Fx1: FNFX1_0230Help
Entry
FNFX1_0230        CDS       T01937                                 

Definition
hypothetical protein (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FNFX1_0230
   00670 One carbon pool by folate
    FNFX1_0230
Enzymes [BR:fcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FNFX1_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(228626..229126)
Genome map
AA seq 166 aa AA seqDB search
MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADRLYITEVDA
EMTDLDAFFPQWDKSKYKRIGHKQFKKDDKNEFNFTFSVFEKIKNL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactaatcgttgcttatgataaaaactttggtataggtaaagaaaatactcta
gcatggaaactatcagaagatcttaagaactttaaaaaaataacagaaaacaactatatt
gttatgggtagaaaaacctttgaatcgattggtcgcccactaccgaatcgtaaaaatatt
attttaactagagacaaagattacaaacaagataaatgtttaataataaatagtactcag
gatattttaaatttcgctgaatcaaaaccacactacgaaatatttataatcggtggtgca
cagatctataaagaatttctaaaatacgcagatagattgtatataactgaagttgatgca
gaaatgactgatcttgatgctttttttccacaatgggataaatcaaaatataaacgtatt
ggtcacaaacaattcaaaaaagatgataaaaatgaatttaattttacatttagtgtattt
gaaaaaattaaaaatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system