KEGG   Francisella cf. novicida Fx1: FNFX1_0505Help
Entry
FNFX1_0505        CDS       T01937                                 

Definition
hypothetical protein (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FNFX1_0505
Enzymes [BR:fcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FNFX1_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495911..497350
Genome map
AA seq 479 aa AA seqDB search
MTKAGLLLAISSLPSRFGIGDLGKSAYEFVDILKQAGTRIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLADYGLLEEASLKKLNANSKKVEYELVRNFKDNYLEEAFNNFQSSKD
KFGQEYNDFITQNSWVKNYAIFKAFRKVNNNQAWSFWPAEYKNWVKEKAIELDQFQREID
YQIFLQFIFYKQWFELREYANKNNIEIMGDLPIYLGFDSADVWEHQEIFLLDENQNPSFV
AGVPPDFFSETGQLWGNPLYDWDKLKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWVEAPGYEFFDTVYKRIPDANIIAEDLGDLRDEVFELRDHYNLKGMKV
FPFHFDLKTARFIDDANIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDKNIFSK
IIKYLLSCEAEYVILPVQDVLELDGTARLNTPGTVGSPNWQWKLSSFDALKGKIVWISQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagctggattattattagctatttcaagtttacctagccggtttggcattggt
gatctgggtaaaagtgcgtatgagtttgttgatattttaaaacaggctgggactagaatt
tggcaggttttacctcttacaccgctaggtttcggcaactctccatatcagtcaagctct
tcttttgctggtgatgaaatctacattagcttagaaaaactagcagattatggtttgctt
gaagaagcatctcttaaaaaactaaatgcaaactctaaaaaagtagaatatgaacttgtt
cgtaatttcaaagataactatctcgaagaagcctttaacaattttcaaagctcaaaagat
aagttcggacaagagtataatgattttataactcagaattcttgggtcaaaaactatgct
atttttaaagcttttagaaaggtaaataataaccaagcttggagtttctggcctgcagaa
tataaaaactgggttaaagagaaagctatagaacttgatcaatttcaacgagagatagat
taccaaatatttttacagtttatcttttataagcagtggtttgagctaagggaatatgct
aataaaaataatattgaaatcatgggtgatttgcctatttatttaggtttcgactctgct
gatgtatgggagcatcaggaaatatttttattagatgagaatcaaaatcctagttttgtc
gcaggcgtgccacctgattttttttcagaaactggtcagctatggggtaatcctctatat
gattgggataaactcaaagaaacaaattttgatttttggatagatcggctaaatggtaat
tttaagctatttgatattgttaggattgaccattttagagcttttgatacttactggaaa
atacctgctggtgaaaaaactgctataaatggcgagtgggttgaggctcctggatatgaa
ttttttgatacagtctataagcgtattccagatgctaatattattgcagaagatttagga
gatttgcgagatgaagtatttgagctacgcgatcactataatctaaagggtatgaaagtt
tttccatttcattttgatctaaaaacagctagatttattgatgatgctaatatcatagct
tattcaggtactcacgataataatactttgaaaggttggtattttgacgagctcaataga
tatcaaagaaaattattaaaacgatattttaaagctaatgataaaaatatctttagcaaa
ataattaagtatttgcttagctgtgaagctgaatatgtaatcctgccagtacaagatgtt
ttagagttagatggaactgctaggctaaatactccgggtacagtaggctcgccaaattgg
caatggaaactatctagttttgatgcgttaaaaggcaaaatagtctggatttctcaataa

DBGET integrated database retrieval system