KEGG   Francisella cf. novicida Fx1: FNFX1_0508Help
Entry
FNFX1_0508        CDS       T01937                                 

Definition
hypothetical protein (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:fcf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:fcf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499750..501213
Genome map
AA seq 487 aa AA seqDB search
MKRINQILKFLDIKTLSQNNFQIESLYLDSRKCDKKSAFVALKGLSTDGNKYIDSVLAKG
VSLVLTDSQEFEDQKRVFYIQNLKEKLSTLAKWFYDYEKPQNIIGITGTNGKTSISSYIA
QFLDLSAQKTLLLGTNGNGIYPNLRESTHTTLDILSLYQTISYYKNYRNLVMEVSSHSLD
QKRVEGLDFDVAIFSNLSHDHLDYHKTMDNYFEAKAKLFQFKRLKKAIINIDDEYGQRLC
NMTQAPVITVSLKSEYADVYIKPKSIEGIKTKFEMFFNGRFVGEYTTKLIGDFNLMNLGL
SFASLDGVLDWDCILDLGNIKPVKGRMEVIELDNDIKIVIDYAHTPDALEKALQTLNSYN
PNNLWCIFGCGGNRDISKRPIMAQIAEEYASKIVITEDNNRFESIENIFSDIRKGFKYPQ
KHIFITSREQAIRFSIENANQGDIILLAGKGHECYLDKNGAKEYFDEREIIKKYAGAFSL
NMINKEI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataaaccaaatattaaaatttctagatattaaaactttatctcaaaataat
tttcaaattgagtctctatatttagatagtcgtaaatgtgataaaaaatcagcgtttgta
gctctcaaaggtctatcaactgatggtaataaatatattgatagtgttttagctaaaggt
gtcagtttagtattaacagatagtcaagaatttgaagaccagaaacgtgttttttatatt
caaaatttaaaagagaaactatcgacccttgcaaaatggttttatgattatgagaaacca
caaaatataataggtataactggtacaaatggtaaaacttctatctctagttatattgct
caatttttagatttaagtgcacaaaaaacgttacttttaggtacaaatggcaatggcatt
tatcctaacttaagagagagtacacatacgacattagatatattgtctttgtatcaaact
atttcatattataaaaactatcgaaaccttgtgatggaagtatcttctcattcattagac
caaaagcgtgttgaaggcttagattttgatgttgctatatttagtaatcttagccatgat
catcttgattatcataagactatggataactattttgaagctaaggcaaaattgtttcaa
ttcaaaagacttaaaaaagctataataaatatagatgatgagtatggtcaaagactgtgt
aatatgacacaggcacctgttatcacagtaagtctaaaatctgaatatgctgatgtctat
attaagcctaaatctatagaaggtattaaaactaagtttgaaatgttttttaatggtagg
tttgttggtgaatatacaactaagcttataggtgattttaacttgatgaatttgggcttg
agctttgcatcacttgatggtgtgttagattgggattgtatattagatctaggaaatatc
aaaccagtgaaaggtcgaatggaagtgatagagctagataatgatataaagatagttatt
gattatgcgcatactccagatgctttagaaaaggctttacaaaccttaaatagctacaat
ccaaataatttatggtgtatttttggctgtggtggtaatagagatatttccaaaagacct
ataatggcacaaatagcggaagaatatgctagcaaaatagtaattacagaagataataat
cgttttgagagtattgaaaatatattcagtgatattagaaaaggatttaagtatccgcaa
aagcatatttttatcacctctcgagaacaagctattagatttagtatagaaaatgctaat
caaggagatattattttattagcaggtaaagggcatgagtgttaccttgataaaaatggt
gctaaagagtattttgatgaacgagaaatcataaaaaaatatgccggagcattctctttg
aatatgataaataaagaaatataa

DBGET integrated database retrieval system