KEGG   Francisella cf. novicida Fx1: FNFX1_0514Help
Entry
FNFX1_0514        CDS       T01937                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00260  Glycine, serine and threonine metabolism
fcf00750  Vitamin B6 metabolism
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf01230  Biosynthesis of amino acids
Module
fcf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FNFX1_0514
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FNFX1_0514
Enzymes [BR:fcf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FNFX1_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N IL6
Motif
Other DBs
NCBI-ProteinID: AEB27462
Position
507942..509228
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVPERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVKRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTHWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQIGFPIDEISMSLNANDTVVDYLETGKFNPKASVVTLANAMD
VGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTATGFVAK
NQLGSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLDKEQHKVVINKSMDELCE
VYTKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcccagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaaaaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagtaatattcgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggggtttttgatgactgtcaaagtctagtcaaagaagcttttaagacacattggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattattaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatc
ggctttccaatagatgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgtaacgctagcaaatgctatggat
gttggtaaccctagtaattttgaaagattgttatatttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacagcaacaggttttgtagcaaaa
aatcagttaggtagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaggtgccacctacaccggcgctacaaaag
ctactagacaaagagcaacataaagtagtgataaataagtctatggatgagctgtgcgag
gtttatacaaaagcttttgaagcttag

DBGET integrated database retrieval system