KEGG   Francisella cf. novicida Fx1: FNFX1_0516Help
Entry
FNFX1_0516        CDS       T01937                                 

Definition
hypothetical protein (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FNFX1_0516
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FNFX1_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(510445..512415)
Genome map
AA seq 656 aa AA seqDB search
MYFGVDYYPEQWDYSLIDEDLNRIANSELNCIRIAEFAWHLMEPIENEFDFSFFEMILNK
AHKLGLKVMLGTPTATVPAWLYKKDPKIFSVDENGLQRHFGGRRQACLNSPTYNKYADRI
TKKMVEAYHKHPALLLWHIDNELGHETSDMCYCDQCELEFRNYLKQQFNNDISSFNNAIG
SVFWSQTYNDFEEINIPRPTIPAPNPGMMLYFNRFRAQTTTNFLARQANIIKDIAPNQQT
LHNFTGDYFSKAQDHTDLAEQIDLVALNNYPVWGGQQIPVDAHKTAMKLDQTRGFHRKNY
WITEQLIGAQAHNIMGFVPRPGHAKLWSFQAMARGCENLIYFRWRTATKGAEQFCYGVLD
HDNKYNHRYNEMLDIIRLAKQNQKAIQAPTQSKVALLYSMDNIYSWRIQQQSTAFNIQHE
HARLYRPFFDENISVDVLDIRHDFSSYSILLLPVAMLITDENISRIKEFIENGGTVIATF
RAGLKEYHNEIRFGVENPIHELAGIKADYFEPLPAGINCKIQYKDNHLTATVWRDMLTVK
GACESLCNYVDEFKNYSAAVKNKLGKGEIYYIGTGIDDEYFWNDLVLDLAKKHNLDAYSS
PSDIEVIIKGEKDSKIAIILNHNSNEIEYIGLKLKAYDTQILKYSEFHKLYSKYYQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtcgactattacccagaacaatgggattattctcttattgatgaagat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgagtttgcttggcat
ctaatggagcctatagaaaatgaatttgattttagtttctttgaaatgatactaaataaa
gctcataaattaggattaaaagttatgttaggaacccctacagcaactgttccagcttgg
ttatataaaaaagatccaaaaattttctctgttgatgaaaatggtttacaaaggcatttt
ggtggtagaagacaggcttgtctaaattcaccgacttataataaatatgctgatcgtatt
acaaaaaaaatggttgaagcatatcataaacacccagctctactactttggcacattgat
aatgagcttggtcatgaaactagtgatatgtgttattgtgatcagtgtgaattagagttt
agaaactatctaaaacaacagtttaataacgacatcagttcatttaataatgctattggc
tctgttttttggtctcaaacttacaatgattttgaggagataaatattcctcgcccaaca
attccagctccaaatcctggtatgatgttatacttcaatcgctttagagcacaaacaaca
acaaactttttagcaagacaagctaatattattaaagatatagcgccaaatcaacaaact
ttacataattttactggggactacttttctaaagcacaagatcatacagatctagcagaa
caaatagatctagttgctttaaacaactatccagtatggggtggtcaacaaatcccagta
gatgcacataaaacagctatgaagttagatcaaactagaggtttccatagaaaaaattac
tggatcacagaacaattgataggtgctcaagcccataatatcatgggatttgtacctagg
cctggacatgccaagctatggtcattccaagctatggctagaggctgtgaaaatctaata
tacttcagatggcgtactgctacaaagggtgctgaacaattttgttatggtgtactagat
catgataataaatataatcatcgctataatgagatgttagatattattagattagcaaaa
caaaatcaaaaggcaatacaagctccaacacaatcaaaagtagcattgctatactcaatg
gataatatctatagctggcgtattcagcaacaatcaacagcttttaatatccaacatgaa
cacgctagattatacagacctttttttgatgaaaatattagtgttgatgtattagatatc
cgccatgactttagtagctattctattctattgcttccagtggctatgctaattactgat
gaaaatatctcccgaataaaagaatttattgaaaatggtggcacagttatagctacattt
agagctggactaaaagaatatcataatgaaattcgttttggcgttgagaatccaattcat
gaattagcaggtataaaagctgactattttgagcctttaccagctggcataaactgtaaa
atccaatataaagataatcatttaacggctactgtctggcgtgatatgcttacagtcaaa
ggggcttgtgaatcactgtgcaactatgttgatgaatttaaaaattatagcgctgctgta
aaaaataaattaggtaaaggagaaatttattatataggcacaggtattgatgatgaatat
ttttggaatgatttagtcttagatttagctaaaaaacataatttagatgcttatagttct
ccgagtgacattgaagttattattaaaggcgaaaaagattctaaaattgctattatatta
aatcataatagtaatgaaatagaatatatagggcttaaacttaaagcatatgatactcaa
atattaaaatactcagaatttcataaattatactctaaatattaccaatag

DBGET integrated database retrieval system