KEGG   Francisella cf. novicida Fx1: FNFX1_0609Help
Entry
FNFX1_0609        CDS       T01937                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FNFX1_0609
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FNFX1_0609
   00052 Galactose metabolism
    FNFX1_0609
   00500 Starch and sucrose metabolism
    FNFX1_0609
   00520 Amino sugar and nucleotide sugar metabolism
    FNFX1_0609
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FNFX1_0609
   00524 Butirosin and neomycin biosynthesis
    FNFX1_0609
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FNFX1_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611805..612770
Genome map
AA seq 321 aa AA seqDB search
MYIGLDIGGSNISAGIFDEQKNLIKTAKVKSKGKSDADVILAQIFKVINKLLDSSNKNKI
KAIGIGIAGFVDSKSGVLNFSANINLNGINIAQEVSQKFANVPVFIENDVNVGVIGEWKY
GAGRGHQNIVGIFAGTGIGGGLVVNNQFLYGVTGGAGAVGHVTINSQGAYCQSCGSQGCL
ETYAGKVGIENRLMNLHKKGIKSILIDFVLENKGKLKGSHLKKALAAKDKIAEDIMTNAM
SNLGVAVANYINLLNPSMVLFGGGIIEAVGQQYLDTIYQSCSKYAFKTMLDACELKIATL
GDNSGVYGAMDIAVNRLEENW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtacataggtttagatattggtggtagtaatatctctgctggtatttttgatgagcaa
aagaatcttattaaaactgcaaaggttaaatcaaaaggcaaaagtgatgctgatgtaatt
ctagcgcagattttcaaagtgattaataaactacttgatagttcaaataaaaataagata
aaagctataggtattggtattgctggttttgttgattcaaaatcaggtgtcttaaatttc
agtgctaatatcaaccttaatggtataaatattgctcaagaagtcagccaaaaatttgca
aatgtaccagtatttatcgaaaatgatgtaaatgtgggtgttattggtgaatggaaatat
ggtgctggtagaggtcatcaaaatattgttggtatatttgcaggcactggtattggtggc
ggtcttgtggtaaataatcagtttttgtatggagttacaggaggtgcaggcgcagttggg
catgtgactattaatagtcaaggagcttattgtcagagctgtggatcacaaggatgttta
gaaacttatgctggtaaagttggtattgaaaatagacttatgaatttgcataaaaaaggt
ataaaaagcatcctgatagattttgttttagaaaataaaggtaaactcaagggttctcac
cttaaaaaagctttagcagccaaagataaaatagctgaagatataatgaccaatgcaatg
tctaatctaggagttgctgtggcaaactatatcaatcttttaaacccatcaatggtattg
ttcggtggtgggattattgaagcagttggacagcagtacttagatactatttatcagtca
tgttcaaaatatgctttcaaaacgatgctagatgcttgtgagttgaaaattgcaacatta
ggcgataattcaggtgtgtatggcgctatggatatagcagttaatcggttagaggaaaat
tggtaa

DBGET integrated database retrieval system