KEGG   Francisella cf. novicida Fx1: FNFX1_0610Help
Entry
FNFX1_0610        CDS       T01937                                 

Definition
(GenBank) Putative ROK-family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00010  Glycolysis / Gluconeogenesis
fcf00052  Galactose metabolism
fcf00500  Starch and sucrose metabolism
fcf00520  Amino sugar and nucleotide sugar metabolism
fcf00521  Streptomycin biosynthesis
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf01130  Biosynthesis of antibiotics
fcf01200  Carbon metabolism
Module
fcf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FNFX1_0610
   00052 Galactose metabolism
    FNFX1_0610
   00500 Starch and sucrose metabolism
    FNFX1_0610
   00520 Amino sugar and nucleotide sugar metabolism
    FNFX1_0610
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FNFX1_0610
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FNFX1_0610
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FNFX1_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEB27558
Position
612770..613717
Genome map
AA seq 315 aa AA seqDB search
MFIGVDIGGSNMAAGLFDENKNLITTAKVKSKAKETTEVVVGQLFKVIDKLIAEIPTGKN
LVGIGIGVAGLIDKKTSIVRRSVNINISGVNLKQIIQDKYAVKSEIDNDVNVGILGEAKY
GAGIGCDDIIGAFVGTGIGGGLVLNGKLYTGNSGLAAELGHTIIKQGGAYCPGCGSQGCL
EAYAGKVGIEKKIENLAKKNIHSTLIDLVMENGGKLKSSHIKKALDDQDEIAMDILSEAM
EYLGTGLGSALNMINPSMVILGGGVMEAIGERYLAQIKRAVMKNSFADIYAECEFKLAKL
GDQAGIYGAMELVAG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtttataggagttgatattggtggctcaaatatggctgcgggcttgtttgatgaaaat
aaaaatctaatcacaacagcaaaggttaaatcaaaagctaaagaaacaactgaagttgta
gtagggcaattattcaaagtaattgataagcttatagcagaaataccaacaggcaaaaac
ctagtaggtattggtataggagttgctgggcttatagataaaaaaacatcaattgtgcgt
agaagcgtcaatattaatattagtggtgttaatttaaagcaaattatacaagataaatat
gctgttaaatctgaaatcgataatgatgtaaatgttggaattttaggtgaagctaaatat
ggtgcaggtattggctgtgatgatattatcggagcttttgtaggtactggtattggcggc
ggtttggtgcttaatggtaagttgtatactggaaatagtggtttagcagcagagcttggc
catactattatcaaacaaggtggcgcctattgcccaggttgtggttcacaaggatgttta
gaagcctatgctggtaaagttggtattgaaaagaaaatagaaaatttagcgaagaaaaat
attcatagcactttgattgatcttgtaatggagaatggcggtaaactaaagagtagtcat
attaaaaaagcactagatgatcaagatgaaattgctatggatatactcagtgaagctatg
gaatatctgggtacaggtttaggaagcgctttaaatatgataaatccatctatggtcata
ttaggtggtggtgttatggaagctattggtgagaggtaccttgcccagataaaaagagcg
gtaatgaaaaattcattcgccgatatttatgcagaatgtgaatttaagctagctaaactt
ggagatcaagcaggtatttatggagctatggagctagttgctggttaa

DBGET integrated database retrieval system