KEGG   Francisella cf. novicida Fx1: FNFX1_0700Help
Entry
FNFX1_0700        CDS       T01937                                 

Definition
hypothetical protein (EC:2.4.2.19)
Orthology
K00767  
nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:fcf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713304..714167
Genome map
AA seq 287 aa AA seqDB search
MADVMLNTDQINKVPNDIVTRLVRESLAEDIATGDITAQLAEDIDTTAFCITREEMILCG
QDFANEVINQLGKNIQITWLYNDAQKVPANARIFELKGNARSILTAERTILNFIQMLSAT
ATATNKLVKLISQYNTKLLDTRKTIPGFRLAQKYAVRCGGGFNHRIGLFDAYLIKENHIR
SAGGIVKAVTKAKKLDSNKVVEVEVTNLDELNQAIAAKADIVMLDNFSGEDIDIAVSIAR
GKVALEVSGNIDRNSIVAIAKTGVDFISVGAITKHIKAIDLSLQVQL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtgatgttgaatactgaccaaattaacaaagttcccaatgatattgttaca
aggctagttagagagtctttagcagaagatatagcaactggagatatcacagcacagcta
gctgaagatattgatactacagcgttttgtatcactagagaagagatgatcttatgtggg
caagattttgctaatgaagtgattaatcagcttggtaaaaatatacagataacttggtta
tataacgatgctcaaaaagtaccagcaaatgctagaatttttgagcttaaaggtaatgcg
cgaagtatcttaacagcggaaagaacgatattaaactttattcaaatgctttctgctaca
gctacagcgacaaataagctagtcaaattgatttctcaatataacacaaaattacttgat
acacgtaagactattccagggtttcgtttagcgcaaaaatatgcggttaggtgtggtgga
ggttttaatcatcgtattggtttatttgatgcttatttaattaaagaaaaccatattcgt
tcagctggtggtattgtcaaagctgtcaccaaagcaaaaaaattagacagcaataaagtt
gttgaagttgaagttacaaacttagatgaattaaatcaagcaatagcggctaaagcagat
attgtaatgctcgataattttagcggtgaagatattgatatagctgtgagtattgctagg
ggtaaagtagctcttgaagtatctggtaatatcgatcgtaattctatagttgctatagct
aaaactggtgttgattttatttctgttggagcgattacaaaacatatcaaagcaatagat
ttatcattgcaggttcagttatag

DBGET integrated database retrieval system