KEGG   Francisella cf. novicida Fx1: FNFX1_0815Help
Entry
FNFX1_0815        CDS       T01937                                 

Definition
hypothetical protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FNFX1_0815
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    FNFX1_0815
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FNFX1_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(843277..844899)
Genome map
AA seq 540 aa AA seqDB search
MMDFRYWGEDSNNQRIPFTKTNDIVDKIFKDYNLGGFILFRENIQNNEQVISLLRDLQAN
TNTPIFFATDQEGGRVNRLQQGTSGCGNMALAATDNPHNAYTMAKIIGDELYSLGININF
APAVDVNSNKNNPIIGVRSYSDNPNVVTDYAKNAINGYHDAKIIDCIKHFPGHGDTATDS
HLGNVILDKTLKELQTTELLPFSKLARDCNMIMTAHISVPALDDSQYISVSTSENIYVPA
TLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAILAGIDILLMPIRVWS
ENDLYKLEELFCELEKEYNQNPNFANAVDNAYTNITDFKAKHKLDESLIFKLSQDEQLKY
ANQIVNCSKHQRTSLDIAKQSTTVVKNSGIIPCDLNKLKNILIVDSDNQRLADFHSELQK
IVLKNNSTTIINIENINNQDIETSIENADIILLISANLREYNQTYSDITSLKPEQIINIA
ALTPYDINYIDNIINYVCIYGATSMDQTNYTKTSLKINIQAALENIFGNKEIKGVLPVSL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgatggattttcgctattggggtgaagattcaaataatcagcgtataccttttacaaaa
accaatgatatcgtcgataagatctttaaagactataatttaggtggttttatccttttt
agagagaatattcaaaataatgagcaagttatctctctattaagagatcttcaagctaac
accaatacaccaatatttttcgctacagatcaagaaggtggcagagttaatcgcttacaa
caaggtactagtggctgcggaaacatggcattagctgcaacagataatcctcataatgcc
tatactatggctaaaataattggcgatgaattatattctttaggtatcaatattaatttt
gctccagctgtagatgtcaactctaacaaaaataatcctattattggtgtaaggtcttac
tcagataatcccaatgtagttactgattatgccaaaaatgctataaatggttatcatgat
gctaaaatcatagactgcattaagcacttccctggtcatggtgatactgcgacagatagt
catttaggtaatgtaatcttagataaaactttgaaagaattacagacaacagagctacta
ccctttagtaaacttgctagagattgtaacatgataatgacagcgcatattagtgttcca
gccttagatgatagtcagtatatatcagtctcaacaagtgagaatatttatgtgccagct
accctctcttataaaataataactaaattactaaaacaacaaatgaaatttgatggttta
gtagtatctgatgccatggacatgcatgctattgctaaacactttggaactattgaggct
tctaaattagctatcttagctggtatagatattttattaatgcctattcgagtatggtca
gaaaatgatctttataaattagaagagcttttttgtgaactagaaaaagaatataatcaa
aatcctaattttgctaatgcagttgataatgcctatacaaatattactgatttcaaagca
aaacataaactcgatgaaagtttaatattcaagctctcacaagatgagcaattaaaatat
gctaatcaaatagttaattgtagtaaacatcaacgaacatctttagatatagccaagcaa
agtacaactgtagttaaaaattcaggtattattccatgcgatctcaataagctaaaaaat
atcttgattgtagatagtgataaccaacgcttagcggattttcatagcgagttgcagaaa
atagtgttaaaaaacaactcaactactatcataaacattgaaaatattaataatcaagat
attgaaactagtattgaaaatgctgatataattttgctaatttcagcaaacttgcgtgag
tataatcaaacttatagtgatataacctctctaaagccagagcaaattataaatatcgca
gcgctcaccccttatgatattaattatatagataatattattaattatgtttgtatttat
ggtgcaacttctatggatcagacaaactatacaaagacttcactaaagattaatattcaa
gcagcattagaaaatatttttggtaataaagagattaaaggagtactaccagtcagttta
taa

DBGET integrated database retrieval system