KEGG   Francisella cf. novicida Fx1: FNFX1_0816Help
Entry
FNFX1_0816        CDS       T01937                                 

Definition
hypothetical protein (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FNFX1_0816
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    FNFX1_0816
Enzymes [BR:fcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     FNFX1_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845005..845787)
Genome map
AA seq 260 aa AA seqDB search
MSVKNKVTLITGAASGLGLGMATEFAKQGAKVVIADLDLEKSQAVAKDLADKYTVETLAV
QMDVTNEDQVKSGVDETVKKFGRIDTVINNAGIQIISPIVDFSISAWKKLFDIHMTGTLL
VTQAAMRHMIELKTGGRIIVVGSVHSVLASKNKAAYVAAKHAQVGFVRALAKEGAEHNIS
SNLIGPGFVMTPLVEKQIPEQAKELNISEEEVVKNIMLGGTVDGEFTTVQDIADTAIFLA
GFKTNALTGQKILVSHGWGM
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaataaagtgactttaattaccggagctgcatcaggtcttggactaggt
atggcgacagaatttgcaaaacaaggcgctaaagtagtaatcgcagatttagatcttgaa
aaatcacaagctgtagcaaaagatttagcagataaatatactgtagaaactttagctgta
caaatggatgttacaaatgaagatcaagtgaaatccggtgtagatgaaaccgttaaaaaa
tttgggcgtattgatactgtaattaataacgcaggtattcagataatatcacctatagta
gattttagtatatcagcttggaaaaaattatttgatatccatatgactggtacattactt
gtaactcaagcagctatgagacatatgattgaactaaaaactggtggtagaattatagtt
gtaggttctgttcactcagttcttgcatcaaaaaataaagcagcttatgtagcagctaaa
cacgcacaagttggttttgtaagagctttagcaaaagaaggtgctgagcacaatatctca
tctaacctaattggtccaggttttgtgatgacgccattagtagaaaagcaaattccagag
caagcaaaagagctaaatatttccgaagaagaagttgtcaaaaatattatgcttggtggc
actgtagatggtgagttcacaacagttcaagatatcgctgatactgctatattcttagct
ggattcaaaaccaatgctctaacaggccagaaaattttagtaagtcatggttggggaatg
taa

DBGET integrated database retrieval system