KEGG   Francisella cf. novicida Fx1: FNFX1_0819Help
Entry
FNFX1_0819        CDS       T01937                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FNFX1_0819
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FNFX1_0819
   00052 Galactose metabolism
    FNFX1_0819
   00500 Starch and sucrose metabolism
    FNFX1_0819
   00520 Amino sugar and nucleotide sugar metabolism
    FNFX1_0819
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FNFX1_0819
   00524 Butirosin and neomycin biosynthesis
    FNFX1_0819
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FNFX1_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848081..848965
Genome map
AA seq 294 aa AA seqDB search
MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEYNAQSVIDVVIETIA
KVFTSEVEGIGVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAKFKVPVFIDNDANCF
AIGQRLYGKGKEHENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYC
SGQFFIKKIGIEGVEILKRARNNDRDAIDIYMQFGKHLGVAIKSIMYTLDPEVIIIAGSI
MSAREYFEKAMWEEIKTFVFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaattcaaattaagaatagaactgtggttggtgttgatatcggtggcact
aaagtgaatgcaggtagggtatgtggagaaaatttattagactcttacttgagcaaaatt
ccgccagatgcagaatataatgctcaatctgttattgatgttgtcatagagactatagca
aaagttttcacttctgaagtagagggcataggcgttggtattcctagtgttgcagatcga
gagaagggaattgtatatgatgtacaaaatattaaatcatggcaagagattcatctaaaa
gaaatactagaggcaaagtttaaagtaccagtttttatagataatgatgctaattgtttt
gctataggtcaaagactatatggcaagggcaaagagcatgaaaatttcgttggtattaca
ataggcacgggtattggtggcggtattatcaataaaggctctttactaaaagactctaat
tgcggagcaggagagtttggcatgttaccatatttagatggaatcttggaggattattgt
agtggccaattctttataaaaaagataggtattgaaggtgttgagatccttaaacgagca
agaaataatgatagagatgctatagacatctatatgcaatttggtaaacatcttggagta
gcaataaagtctataatgtatactttagatccagaggtgataataattgcaggatcaata
atgtcagctagagaatattttgaaaaagcaatgtgggaagagattaaaacatttgtcttt
actcagtcggctaaaaaaattaaaatagaatggtcagaaaccgaaggtgacttccaagtt
tttggtgctgcagctgtttatttggatagaagtagcaatttatga

DBGET integrated database retrieval system