KEGG   Francisella cf. novicida Fx1: FNFX1_0839Help
Entry
FNFX1_0839        CDS       T01937                                 

Definition
hypothetical protein (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FNFX1_0839
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FNFX1_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(867382..867999)
Genome map
AA seq 205 aa AA seqDB search
MMKDKYCSKLGKSVQEHLIRLGLEQPREFNLDNDNKIAIITKAYRQILDALGLYTDEFEK
TPFRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTA
EVSFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFETLKFILSTEDVSVKIKAKHA
CVSLRGVNNQNSQTYTQMVGGVFAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagataaatattgctctaaattaggtaaaagtgtccaagaacatctcatcagg
ttaggtttagagcaacctagagaatttaatcttgataatgataataaaatagccataata
accaaagcataccgacaaattttagatgctctcggcttatacacagatgaatttgaaaaa
actccatttagagtagcgaggatgtttactcaagaaatatttaatggtcttgattatgct
aatttccctgcttgtgctttatacgagaacgagtttaactatactggtgtgctaactcaa
aaaaatataactataatgtcattttgtgagcaccattttgtaccttttgaaggtactgca
gaagtttcttttattcctaaaaataataatattatagggctttgtcgtataaatagcatt
tgtgactttttttccagacgcccacaaatacaagaaagaatgaccgctcaaatatttgag
accttaaaattcattttatcgacagaagatgttagtgtgaagattaaagcaaaacatgct
tgtgtctcacttagaggggtaaataatcaaaattctcaaacatatacacaaatggttggt
ggagtttttgctaaataa

DBGET integrated database retrieval system