KEGG   Francisella cf. novicida Fx1: FNFX1_0969Help
Entry
FNFX1_0969        CDS       T01937                                 

Definition
hypothetical protein (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FNFX1_0969
Enzymes [BR:fcf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     FNFX1_0969
Peptidases [BR:fcf01002]
 Cysteine Peptidases
  Family C44
   FNFX1_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992796..994649
Genome map
AA seq 617 aa AA seqDB search
MFHGIFFRKDSNLDKIPQQIVDGTNPKLNIDPQRKIIKTIYDKNYWFAQALEKDSNKSIY
IQKNIIIVGWIKLYNRDEIFSELQLEYTEKISDEELIVSLYNKYKSSVTKYLHGDYSFVI
FDSLNNQAACVRDHMGTRPFYYYLDENIFVFSSSQVLFNLLDIIDISASQEWICRLIAGG
TNMNFKKTAYNEIFKIPPAHFLEISNHHSQIQKYFEFSTEKIIFNNDSQYFEEYENKVKK
AIIERFINSKHPIGSEISGGVDSSTVTAYIANYFDQPISNFYTYGFTKLEQEPEYALLVN
QIYGLPNAFICSGNSYDENNCKNPLDILGAPVEHGNATFHEIFYKNASQNGIRSLFSGFG
GDEFVTSIHGDLVAFELLAKKDYIGICKHFGGNIITKPLRILRFLVKNNIKRGKKSFNML
NAFKQRWPYFCVKGEFIKKYHLKDRYFEVANFDNGYTNLDKFTLEKRWVSFVPTRTDNCS
LMAAAYGIDYFWPLLDVRLIQSFLSMPNTLKFHNGYGRYLHRKAVEKIVPKKIIWKKSKY
MGEPFTSKINIKSKLELDTDLHPQLLILLDIDKLKTQIADYNNSIEIDKSINMVINRNIA
DINAINQWLKHFNLKIK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcacggcattttttttagaaaagatagtaacttagataaaattccacagcaaata
gttgatggaacaaacccaaaattaaatatagatcctcaaagaaaaataattaaaacaata
tacgataaaaattactggtttgctcaagcattagaaaaagattcaaataaaagtatttat
atacaaaaaaatattattattgtaggttggataaaactatataatcgtgatgaaattttc
tcagaattacagttagaatatactgaaaaaatctcagatgaagaacttattgtatcatta
tataacaaatataaaagctcagttaccaagtacctccatggcgactactcttttgttatt
tttgatagcttaaataatcaagctgcatgtgttagagaccatatgggaactagaccattt
tattattatttagatgaaaatatttttgttttttcttcatctcaagttctatttaacctt
ttagatataatagatatctccgctagccaagaatggatatgtaggctaatagctggtggt
acaaatatgaatttcaaaaaaactgcctataatgagatttttaaaatccctccggcgcat
tttttagaaatttctaatcaccatagtcaaatacaaaaatattttgaattctctactgaa
aaaataatttttaataatgatagtcaatattttgaagaatatgaaaacaaagttaaaaaa
gcaattattgagaggtttatcaatagtaagcaccctatcggtagtgaaattagtggtggt
gtagattcctccacagttactgcttatatcgctaattattttgatcagcctataagtaat
ttttatacatacggatttactaaactagaacaagaaccagaatatgccctgcttgtaaac
caaatttatggtttacctaatgcctttatttgttctggaaatagttatgatgaaaataat
tgtaaaaatcctctagatattttaggagctcctgttgagcatggaaatgctacatttcat
gagatattttataaaaacgcttctcaaaatggcattagaagtttattttctggtttcgga
ggcgatgaatttgttacatcaatacatggtgatttagttgcttttgagttgttagctaaa
aaagattatataggaatatgtaaacactttggtggaaatataatcactaaacctctaaga
atattacgttttttagtaaaaaataatattaaacgtggtaaaaaaagctttaatatgctt
aatgctttcaaacaacggtggccatatttctgtgttaaaggtgagtttatcaaaaaatat
cacctcaaagatagatattttgaagtagccaattttgacaatggctataccaacttagac
aaatttaccttagaaaaaagatgggttagttttgtaccaacacgtaccgacaactgttca
ctcatggctgctgcctatggcatagattacttttggccattacttgatgttagattgatt
caaagcttcttatcaatgccaaatacgctaaaatttcataatgggtacggtaggtatcta
catagaaaagcagtagaaaaaattgttcctaagaaaattatatggaaaaaaagtaaatat
atgggtgagccttttactagcaaaataaatattaagtctaaattagaactagatacggat
ctacatccgcaactgctcatattacttgatatagacaagctaaaaactcaaatagcagat
tataataactctattgaaattgataaaagtattaacatggttataaatagaaatattgct
gatattaatgctataaaccaatggttgaaacactttaacttgaaaataaaatga

DBGET integrated database retrieval system