KEGG   Francisella cf. novicida Fx1: FNFX1_1064Help
Entry
FNFX1_1064        CDS       T01937                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FNFX1_1064
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FNFX1_1064
DNA repair and recombination proteins [BR:fcf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FNFX1_1064
    RecFOR pathway proteins
     FNFX1_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH 5_3_exonuc Transposase_20 HHH_3 IMS_HHH MutS_I HHH_4 Cdd1
Motif
Other DBs
NCBI-ProteinID: AEE87450
Position
complement(1079022..1079672)
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSAVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTAAEVIRKALQGSIRSKR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttacttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacggtgccaggaattggtaaaaaaact
gctgagcgcttagttgtagaaatttatgataagttattaaaaatggcaaatgagatttat
gctcagacttcaggtacgactacaactagccaagattcacaagcacaacaagctccaaca
tctgcagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagca
gcagaggtaattcgtaaagctctgcaaggatcaataagatcaaaaagataa

DBGET integrated database retrieval system