KEGG   Francisella cf. novicida Fx1: FNFX1_1086Help
Entry
FNFX1_1086        CDS       T01937                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00260  Glycine, serine and threonine metabolism
fcf00750  Vitamin B6 metabolism
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf01230  Biosynthesis of amino acids
Module
fcf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FNFX1_1086
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FNFX1_1086
Enzymes [BR:fcf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FNFX1_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP LeuA_dimer PK_C DUF99
Motif
Other DBs
NCBI-ProteinID: AEE87472
Position
complement(1100010..1101716)
Genome map
AA seq 568 aa AA seqDB search
MNINEISKKINKDYFTQASPCLSKYIPFMPIKDPSSFVSLRESATPLLKSKIIGKELGIN
LYFKVEGKNPTGSFKDRGSAVDITVAKELGAKGIVLASTGNMAASCACYAAAAKMPCFII
VPEGVAASKLAQVMSYGGKIVQVKGSYNEAAKLAYDIAKSKDFFLAGDYAFRVEGQKTAA
FELIDQLLFQVPDEVIIPIGCGTNMTAYYKGFCEYKELGFINSLPKLTGVQSTEADTLAR
AYQKNQNRIEPLKTANTIATAIAVPYPIDGDKAIDAIYSTGGESTAVTDMKMLEAQYLLS
TKEGLFVELASASTIAHLLKKYEEGRLQKGSTVVCVLSGEGLKDPGVVLKSAIQPPIIYP
SETDFDRLYNSHFFDNKTMLFIEQNEVIFDKLPTLDEVKKTLGKLFGANYDESFVAKVRE
LIERFLVKGKSINVSDIQDIIQDATEMADAVSKDVLDVKSFKVKVELDQKSVAEVTVKVA
EQLYFASSSGVGPVDAVLNALCKACPSDISYNLTDYKVKIRGQGADAVVYVEMSLEKEGI
KSIGKAVSPDIIQASVEAFIDAYNIAYA
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaatgaaataagtaaaaaaattaacaaagattattttactcaagcctcgcca
tgtttatctaagtatattccctttatgccgataaaagatccatcaagctttgtatcttta
agagaatcagctacaccattgcttaagagtaaaataataggcaaagagttaggaattaat
ctatactttaaagtcgaaggtaaaaaccctactggttcatttaaagatagaggatcagca
gttgatataacagttgcaaaagagcttggagctaagggtatcgtgctagcatctactggt
aacatggcggcttcatgtgcttgttacgctgcagctgcgaagatgccttgctttattatt
gtgccagaaggtgtagcagcttctaagttagctcaggtaatgtcttatggggggaaaata
gttcaggttaagggtagttataacgaagctgcaaagttagcttatgatattgcaaaatca
aaagatttcttcttggctggagactatgcttttagagttgaaggtcaaaaaaccgcagca
tttgaactaatagatcagttattgttccaagtgccagatgaggttataatacctataggt
tgtggcacaaatatgacagcttattataaaggtttttgtgagtataaagagttaggtttt
attaattctttacctaagcttactggtgttcaatctactgaagctgataccttagctaga
gcatatcagaaaaatcaaaatagaattgagcctttaaaaacagcaaatacaatagcaaca
gcaatagctgtgccgtatcctatcgatggtgataaagctatagatgctatatatagtaca
ggtggagaatctacagctgtaacagatatgaaaatgttagaggctcaatatttgctatct
actaaagagggattatttgttgagttagcatccgcgtcaactattgcacacttactcaaa
aagtatgaggaaggaaggcttcaaaaaggtagtacagtagtatgtgtattatctggagaa
ggtctaaaagatccaggtgttgtgcttaaatcagctattcaaccaccaattatatatcct
tcagaaacagattttgacagactgtataatagtcatttttttgacaacaagacgatgtta
tttatagagcaaaatgaagttatatttgataaattacctactcttgatgaagtcaaaaaa
actcttggtaaactttttggtgctaactatgatgagagttttgtagctaaggttagagag
ttgattgagagattcctagttaagggtaaatcaatcaatgtttctgatattcaagatatt
atccaagatgctacagagatggcagatgctgttagcaaagatgttttagatgttaaatca
tttaaggtaaaagtagaattagatcaaaaatctgttgctgaggttactgtaaaagtcgct
gaacagttatactttgcatcaagctctggtgtcggacctgtcgatgctgttttaaatgct
ttgtgtaaagcttgtcctagtgatattagttataatctaactgactataaagtaaaaata
cgtggacagggtgcggatgctgttgtttatgttgaaatgagtttagaaaaagaaggtatc
aagagtattggtaaagcagtatctccagatataattcaggcttcggttgaagcatttatt
gatgcctataatattgcatatgcttaa

DBGET integrated database retrieval system