KEGG   Francisella cf. novicida Fx1: FNFX1_1246Help
Entry
FNFX1_1246        CDS       T01937                                 

Definition
hypothetical protein
Orthology
K06187  
recombination protein RecR
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FNFX1_1246
DNA repair and recombination proteins [BR:fcf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FNFX1_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1270406..1271008
Genome map
AA seq 200 aa AA seqDB search
MTSKIFSPKISAVIESLRKLPTIGKKSSQRLTLYLLDKSPETAIAIANSLLDATANIKKC
VYCQALTEDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYFVLNGRISPLDGI
GPSELKLDILQQIIADRKIDEVILAISPTVEGETTAHFISQMIAKDIKISRIGFGVPFGG
ELEYLDQQTLLHAFNARTNI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaattttttctccgaaaattagcgctgtaatagaatctttgcgtaagcta
ccaactattggtaaaaaatcatcacaaagacttactctatatctactagacaaatcacct
gaaacagcaatagctattgccaactcgcttttagatgccacagcaaatatcaaaaaatgt
gtatattgccaagcacttactgaagacgatgtttgtaacatatgtagtaacactaatcga
gatgataccaaactatgtataatagaaagtatgcttgatatgattgctattgaagaggct
ggtatctatagaggtaagtattttgtattaaatggtagaatttctccgctagatggcata
ggtccaagtgaattaaagctagatatcttacaacaaattatcgctgatagaaaaatcgat
gaggtaattcttgcaattagcccaactgtagaaggtgaaacaacagctcattttatttca
caaatgattgccaaagatataaaaatctcacgcatcggttttggagtaccatttggtggt
gaattagaatacttagatcaacaaactttactacatgcttttaatgcaagaactaatatt
taa

DBGET integrated database retrieval system