KEGG   Francisella cf. novicida Fx1: FNFX1_1394Help
Entry
FNFX1_1394        CDS       T01937                                 

Definition
hypothetical protein (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FNFX1_1394
Enzymes [BR:fcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FNFX1_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433202..1434959)
Genome map
AA seq 585 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFDLAKNLPKSSKNNCHSGLDPESLKYSKNENVLF
HILIKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIANILDSLNYD
NLPIYFAKQYDSLYIKRLWNYEVEIANFIKSRTIQNTQQDNHIEEVVDKLFEPTDEIDWQ
KQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKVAQRMTES
LNSVLSKRVDNDSYLGLSNLEAQTIHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASMLD
MNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLLANFTHDKYGSITPYTTLLIKNYRSQ
QYINNLAASVLKGDVNIDSQQNENIKFHSLRNLDIYLREYAKRYSQLEKCRDYKEALTEL
NKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNSYSLGLFNGDVGIMW
SDDTGKLRAYFDGKDAKTFSLNMLPKFESVYAMTIHKTQGSEFDEVVIILPVEDNEALSK
QLLYTAITRAKYKLTIISEQSSLRDIAQKDIKRNSNISELVSLSD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttgatttagctaaaaatttacctaaaagctcaaaaaataat
tgtcattccgggcttgatccggaatctctaaaatatagcaaaaatgaaaatgtattgttc
catattttgataaagcttatgcatgtatatagccatggtcatagctgtttgaagatagca
gatatatcaaataaaactatttttgcttcagagcaaagtaatcagagtgatgctaaagta
ggctttaaaatgccaagctctgataaaattgcaaatattttagatagcttaaattacgat
aacttacctatatattttgccaaacagtatgattctttgtatattaaaagattgtggaat
tatgaggttgaaatagctaattttataaaatcaagaactatccaaaatactcaacaagat
aaccatattgaagaagttgtagataagctatttgaacctactgatgagatagattggcaa
aaacaggcagttatcaaaagtctaaattataattttagtattatctcaggtggacctggc
acaggtaagacaactacagtcgcaaagcttttacttgccatacaaatgcttaatcaaaat
cagcaaagaatagcgcttttagcaccaactggcaaggttgctcagagaatgacagaatcc
ttaaatagtgtattaagtaaaagggtagacaatgatagttatttggggttatctaattta
gaagcacaaactatacacagatttttaggcttaagaccaaactctacttatgttaaatat
aaccaacaatctaaagcaccattcgatgttattattgttgatgaagcttctatgcttgat
atgaatatttttatcaagttaattagagctgtagcagataatactaagttgatattaata
ggtgatactaatcagttaccatctgttgaggctgggagtcttttagcaaactttacacat
gataaatatggtagcattacgccatatacaacattacttatcaaaaactatcggtcacaa
caatatataaataatcttgcagcctcagtcctaaaaggcgatgttaatattgatagtcaa
caaaatgaaaatattaaatttcatagtctaagaaatttagatatttatttaagagagtat
gcaaagagatattcacagcttgaaaagtgccgtgactacaaagaggctcttaccgagcta
aataaatttagaatacttgtggctaacaaaaacctagaaattggtacagataagttaaat
cagaaaattgagaagtttatgtctaagcctatagattctaactataagggtaaaccaatt
atgataactcaaaatagttattcattagggttatttaatggagatgtagggattatgtgg
tctgatgatactggtaagctccgagcatattttgatggtaaagatgctaagacatttagt
ctaaatatgctaccaaaatttgaaagtgtttatgcgatgacaattcataaaactcaaggc
tcagagtttgatgaggtagttataatacttccagtagaggataatgaagcgctaagtaaa
caacttttgtatacagctattactagagcaaaatataaattaacgattatatctgaacaa
agtagcttaagagatattgctcagaaagatattaagagaaattcaaatatcagtgaatta
gttagcttgagtgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system