KEGG   Francisella cf. novicida Fx1: FNFX1_1394Help
Entry
FNFX1_1394        CDS       T01937                                 

Definition
hypothetical protein (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fcf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433202..1434959)
Genome map
AA seq 585 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFDLAKNLPKSSKNNCHSGLDPESLKYSKNENVLF
HILIKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIANILDSLNYD
NLPIYFAKQYDSLYIKRLWNYEVEIANFIKSRTIQNTQQDNHIEEVVDKLFEPTDEIDWQ
KQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKVAQRMTES
LNSVLSKRVDNDSYLGLSNLEAQTIHRFLGLRPNSTYVKYNQQSKAPFDVIIVDEASMLD
MNIFIKLIRAVADNTKLILIGDTNQLPSVEAGSLLANFTHDKYGSITPYTTLLIKNYRSQ
QYINNLAASVLKGDVNIDSQQNENIKFHSLRNLDIYLREYAKRYSQLEKCRDYKEALTEL
NKFRILVANKNLEIGTDKLNQKIEKFMSKPIDSNYKGKPIMITQNSYSLGLFNGDVGIMW
SDDTGKLRAYFDGKDAKTFSLNMLPKFESVYAMTIHKTQGSEFDEVVIILPVEDNEALSK
QLLYTAITRAKYKLTIISEQSSLRDIAQKDIKRNSNISELVSLSD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttgatttagctaaaaatttacctaaaagctcaaaaaataat
tgtcattccgggcttgatccggaatctctaaaatatagcaaaaatgaaaatgtattgttc
catattttgataaagcttatgcatgtatatagccatggtcatagctgtttgaagatagca
gatatatcaaataaaactatttttgcttcagagcaaagtaatcagagtgatgctaaagta
ggctttaaaatgccaagctctgataaaattgcaaatattttagatagcttaaattacgat
aacttacctatatattttgccaaacagtatgattctttgtatattaaaagattgtggaat
tatgaggttgaaatagctaattttataaaatcaagaactatccaaaatactcaacaagat
aaccatattgaagaagttgtagataagctatttgaacctactgatgagatagattggcaa
aaacaggcagttatcaaaagtctaaattataattttagtattatctcaggtggacctggc
acaggtaagacaactacagtcgcaaagcttttacttgccatacaaatgcttaatcaaaat
cagcaaagaatagcgcttttagcaccaactggcaaggttgctcagagaatgacagaatcc
ttaaatagtgtattaagtaaaagggtagacaatgatagttatttggggttatctaattta
gaagcacaaactatacacagatttttaggcttaagaccaaactctacttatgttaaatat
aaccaacaatctaaagcaccattcgatgttattattgttgatgaagcttctatgcttgat
atgaatatttttatcaagttaattagagctgtagcagataatactaagttgatattaata
ggtgatactaatcagttaccatctgttgaggctgggagtcttttagcaaactttacacat
gataaatatggtagcattacgccatatacaacattacttatcaaaaactatcggtcacaa
caatatataaataatcttgcagcctcagtcctaaaaggcgatgttaatattgatagtcaa
caaaatgaaaatattaaatttcatagtctaagaaatttagatatttatttaagagagtat
gcaaagagatattcacagcttgaaaagtgccgtgactacaaagaggctcttaccgagcta
aataaatttagaatacttgtggctaacaaaaacctagaaattggtacagataagttaaat
cagaaaattgagaagtttatgtctaagcctatagattctaactataagggtaaaccaatt
atgataactcaaaatagttattcattagggttatttaatggagatgtagggattatgtgg
tctgatgatactggtaagctccgagcatattttgatggtaaagatgctaagacatttagt
ctaaatatgctaccaaaatttgaaagtgtttatgcgatgacaattcataaaactcaaggc
tcagagtttgatgaggtagttataatacttccagtagaggataatgaagcgctaagtaaa
caacttttgtatacagctattactagagcaaaatataaattaacgattatatctgaacaa
agtagcttaagagatattgctcagaaagatattaagagaaattcaaatatcagtgaatta
gttagcttgagtgattaa

DBGET integrated database retrieval system