KEGG   Francisella cf. novicida Fx1: FNFX1_1408Help
Entry
FNFX1_1408        CDS       T01937                                 

Definition
hypothetical protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FNFX1_1408
Enzymes [BR:fcf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FNFX1_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1452638..1453387)
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPQNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTQCHKFETYSRVFIDLDELVETYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
SRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcagaatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcggtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatcgatttgtttaaaaataaaaagatctatagtgtcggtgccagt
actgctgctatattagaaaaatatcaattagctgcaatatatccagttagacatggctca
caagaacttctagatatcatattaaatcaagatatttctaaagaaaagtttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaagttaacacagtgtcat
aaatttgagacatattcacgagtttttatagatcttgatgagttggtagaaacttataat
aaactttttttgcataatcagccggatattataattgctacaagccttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
agtagaaaaaaacacccagcaacaaaatag

DBGET integrated database retrieval system