KEGG   Francisella cf. novicida Fx1: FNFX1_1497Help
Entry
FNFX1_1497        CDS       T01937                                 

Definition
hypothetical protein (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fcf01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fcf01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545936..1546766
Genome map
AA seq 276 aa AA seqDB search
METQSNKLTIVAFAIMHLACLAIFFLNYNITALVVFVVTFSARTFALTAGYHRYFAHKAF
QTSRVFQFILALVGTWASQKGPLWWSGHHRYHHIHSDKDTDLHSPKNGIFQSHVGWVFES
RSDHVDPKFTKDWVKYPELVWIDKYAHVSFALYLVGLFALGSLVSHFYPSLETSGLAFVF
WGGILSTVLLYHTTFSVNSICHIFGSKDYETSDNSRNNWFIALITFGEGWHNNHHKFAYS
VRNNLKVWQIDITYMILCVLRKFGIVWDFKQPKKTI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacagtctaataaattgacaatagtagcatttgctattatgcacttagcctgc
ttggcaatattttttttaaattataatattacagcgctagttgtatttgttgttacattc
tcagctagaacatttgctttgacagctggataccatcgttactttgcacacaaagctttt
caaacctctagagtgtttcaatttatcttagcgttagtaggtacttgggcatcgcaaaaa
ggaccgctttggtggtcaggacatcatagatatcatcatatccattctgataaagataca
gacctacactcgcctaaaaatggtatctttcaatcacacgtaggctgggtttttgaatct
agaagtgatcatgttgatcctaaatttactaaagactgggttaagtatcctgagctagta
tggatagataaatatgctcatgtatcatttgctctatatctggtagggctttttgcttta
gggagcctagttagccacttttatccaagccttgaaacatctggactagcatttgtcttc
tggggagggatattaagtaccgtcttactatatcatactacttttagtgtaaactcaatt
tgccatatctttggatctaaagattacgaaacttcagataatagtcgcaacaattggttt
atagctctaattacatttggtgaaggttggcataataatcatcataaatttgcttactcg
gttagaaataatcttaaagtatggcaaatagacattacctatatgattttatgcgtttta
agaaaatttggaatagtttgggattttaagcaaccgaagaaaactatttag

DBGET integrated database retrieval system