KEGG   Francisella cf. novicida Fx1: FNFX1_1519Help
Entry
FNFX1_1519        CDS       T01937                                 

Definition
hypothetical protein (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fcf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1568873..1570030)
Genome map
AA seq 385 aa AA seqDB search
MFKKTKITILGATGSIGDSTLAVIRETNDFEVFALTAFSNVEKLAKLCQEFKPKFAVVPD
LSKKQKLQSLVTDVEVLVGESGLEKVSSLAEVDIVMSAIVGIAGLKPTFAAAKAGKKILL
ANKESLVTAGHLLIDEVVKNNAQLIPVDSEHNAIFQCIDNHDKKFLPEIDKIILTASGGP
FRDKQLHELTDVTPEQACNHPNWQMGRKISVDSSTMVNKALEVIEAYWLFSVSADKIGVL
IHPQSVIHSMVRYVDGSYIAQLGVPDMKTPIANAMYYPKRGSVNVESLDFTKYQLTFREA
CFERFGALKIVFNNLQNKNYAANIVFNAANEELVAAFLNKKIKYLEIIEVNKKVTKELNF
ENPKNIEEVFEIDRKTREYVDSVLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaactaagattactatattaggagctacaggatctataggtgatagcacc
ttagctgttattagagagactaatgattttgaagtttttgcattaactgcatttagtaat
gttgaaaagctggcaaagctatgtcaagagtttaagcctaaatttgctgtagttccagac
ttgtcaaaaaaacaaaagttacaatcattagtcactgatgtagaggttttggttggtgaa
agtgggcttgaaaaagtatctagcttagcggaagttgatattgtcatgtctgctatagtt
ggtatagcaggattaaaaccaacctttgcagcagctaaagctggtaagaaaattttgctt
gctaataaagaatctttggtaacagcaggacacttgctgatagatgaggttgtaaagaat
aatgctcaacttattcctgtggatagtgaacataatgctatatttcagtgtattgataat
catgataagaagtttttgccagagattgataagataattttaacagcatctggaggtcct
tttagagacaaacaactacatgagttaacagatgtaacacccgagcaagcatgcaatcat
cctaattggcaaatgggcagaaaaatatcggttgattcatcaactatggtaaataaagcg
ttagaagttatcgaagcgtattggcttttttctgtttcagctgataaaataggcgttctg
attcatccgcagagtgtaattcattctatggtcagatatgttgatggtagctatatagca
cagttaggtgtgcctgatatgaaaacacctatagccaacgcaatgtactatccaaagaga
ggatcagttaatgttgagagcttagattttacaaaatatcagctaaccttcagagaagct
tgttttgagagatttggagctttgaaaatagtttttaataatttacaaaataaaaattat
gctgctaacatagtttttaatgctgctaatgaggagcttgtggctgcatttttaaacaaa
aaaattaaatatttagagataatagaagtaaacaaaaaagtaacaaaagagttaaatttt
gagaatccaaaaaatatagaagaagtttttgaaatagatagaaaaactcgtgaatatgtg
gattctgttttggggtaa

DBGET integrated database retrieval system