KEGG   Francisella cf. novicida Fx1: FNFX1_1620Help
Entry
FNFX1_1620        CDS       T01937                                 

Definition
hypothetical protein (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FNFX1_1620
Enzymes [BR:fcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FNFX1_1620
Exosome [BR:fcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FNFX1_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1687442..1688944)
Genome map
AA seq 500 aa AA seqDB search
MSKDFILAVDQGTTSSRAIIFDKKGNIRKIAQKEFTQIYPKSGWVEHDAMEIWGTQSGVM
REALEFGRVKPDQIVAIGITNQRETVVVWDKETGDPVYNAIVWQCRRTSSICDEIKRDPQ
FVKYIKENTGLVVDAYFSGTKVKWILDNVEGAREKANAGKLLMGTIDTWLIWNLTRGKVH
ATDYSNASRTMLFNINSLEWDKKILDYLNIPESMLPKVKNSSEVFGVTDSHTLGGAEIPI
AGVAGDQHAALFGHCCFEKGMAKNTYGTGCFALMNVGDKPVYSDEGLLTTIAWAENGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTGLDLAGLRVDGGAVQNNFLM
QFQSDILQSEISKPKINEITGLGAVFLAGLAVGFWKDKQELKSILTTEKVFEPQKDSQAV
AHDYRGWKKAVERSKGWAEC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatttcatcttagctgtagatcaaggtacaacaagttcacgagcaattatc
tttgataaaaagggtaatataagaaagattgctcaaaaagaattcacacaaatatatcct
aaaagtggttgggtagaacatgatgcaatggaaatatggggtactcaaagtggcgtaatg
cgtgaggcactagagtttggccgcgttaagccagatcaaattgtcgcaataggtattaca
aatcagcgcgagacagttgtagtttgggataaagaaacaggtgatcctgtctataatgct
atagtgtggcaatgtcgccgtacttcgagtatttgtgatgaaatcaaacgagatcctcaa
tttgtcaaatatatcaaagaaaatactggtctggttgtagatgcgtatttttcaggcact
aaagtaaaatggattttagataatgttgaaggtgctagagaaaaagcaaatgccggcaaa
ttattaatgggtactatagatacttggttgatttggaatctaactcgcggtaaagtgcat
gcgacagactatagtaatgcttcgcgcactatgttatttaatattaacagtttagagtgg
gataaaaaaatacttgattacttaaatattcctgaatcaatgttacctaaggttaaaaac
tcaagtgaggtttttggagttacagatagccatactttaggcggtgctgagattcctatt
gcgggtgttgcaggagatcagcatgcagcattatttggtcattgttgttttgaaaaaggt
atggcaaaaaatacttatggtacgggttgttttgcgttgatgaatgtcggcgataagcca
gtttattcagatgaaggtttattgaccactattgcatgggcagaaaatggtaagccaact
tatgctttagaaggtagtgtctttatagcaggagctgttattcagtggattcgtgatggt
ttgggactagtgcgttctgctgaggatagtgagtactatgctactaagattgattctaca
aatggtgtatatttggtgcctgcgtttgttggtcttggcacaccatattgggatatgtat
gctcgtggtacgatagttggcattacccgtgatacaaagcgtgagcatattattcgtgcc
gctctagaggctatagcatatcaagctaaagatgtgttagaatgtatgaaagaggatacg
ggacttgatcttgctggtttgcgtgttgatggtggcgcggtacaaaataacttcctaatg
cagtttcaatctgatattttacaatctgaaatctcaaaaccaaaaataaatgaaattact
ggtttgggagctgtcttcttagctggtttagcagttggtttttggaaggataaacaagaa
ttgaaatctattcttacaactgaaaaagtttttgagccgcaaaaagattctcaagctgtt
gctcatgattataggggttggaagaaagcagtagaaagaagtaagggttgggcagagtgt
taa

DBGET integrated database retrieval system