KEGG   Francisella cf. novicida Fx1: FNFX1_1671Help
Entry
FNFX1_1671        CDS       T01937                                 

Definition
hypothetical protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FNFX1_1671
   01230 Biosynthesis of amino acids
    FNFX1_1671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FNFX1_1671
   00051 Fructose and mannose metabolism
    FNFX1_1671
   00562 Inositol phosphate metabolism
    FNFX1_1671
Enzymes [BR:fcf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FNFX1_1671
Exosome [BR:fcf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FNFX1_1671
  Exosomal proteins of bladder cancer cells
   FNFX1_1671
  Exosomal proteins of melanoma cells
   FNFX1_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1745661..1746422)
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVG
LQNITFYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTIT
PVVCIGESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQ
IQETHQFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggtaactggaaaatgaatggtaactctacaagcataaaagag
ctctgtagtggtatatcacaagtgcaatatgatacttcaagagtagctattgctgttttt
ccatcaagtgtttatgttaaagaagtaatctcacagctgccagagaaagtaggtgttggt
ctacaaaatattactttctatgatgatggtgcttatactggcgagatatctgctagaatg
ttggaagatattggttgtgactatttactaattggtcattctgagagaagatctctattt
gctgagtctgatgaagatgtttttaaaaagcttaacaagattatagatactactataacg
ccagtagtgtgtattggtgaatcactagatgatagacaaagtggtaagctcaaacaagtt
ttagcaacacaactaagcttaatcttagaaaatttatctgttgagcagttagcaaaagtc
gtaattgcatatgaacctgtctgggcaataggcacaggagttgtggcttcactagagcag
attcaagaaacacatcaatttattcgttcattgttagctaaagttgatgaaagacttgct
aaaaatataaaaatagtgtatggtggtagcctaaaagctgaaaatgctaaagatatatta
agcttaccagatgttgacggtggtttaattggtggcgcatctttgaaggctgctgaattt
aacgaaataataaatcaagcaaacaagatatgtacggaataa

DBGET integrated database retrieval system