KEGG   Francisella cf. novicida Fx1: FNFX1_1674Help
Entry
FNFX1_1674        CDS       T01937                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00020  Citrate cycle (TCA cycle)
fcf00310  Lysine degradation
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf01130  Biosynthesis of antibiotics
fcf01200  Carbon metabolism
Module
fcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fcf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FNFX1_1674
  Amino acid metabolism
   00310 Lysine degradation
    FNFX1_1674
Enzymes [BR:fcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FNFX1_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 QRPTase_N RnfC_N T2SSB GCV_H
Motif
Other DBs
NCBI-ProteinID: AEE88059
Position
complement(1748335..1749804)
Genome map
AA seq 489 aa AA seqDB search
MVELKVPMFPESVADGTLAQWNKNEGDFVNEGDILAEIETDKVVLEVPATSSGVLKGIKK
HAGDTVLSEESLAIIDTAASTSEPNQQTTNQRNASEATATGQEIDIKAPVFPESVADGTI
SEWHKKEGEAVSEGDILAEIETDKVVLEVPATSNGVLTKILKPAGETVLSAELIAKITAG
GATTTTKSEASVGVSQANNDPHLVPSARKAFNASGLDTAANIEGTGKKGRITSEDVKKAV
TSVNKPQQQTVVINQGARYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMEL
RNKYKDMFVKEHDTKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTD
RGLVVPVLRDTDTKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTP
IINSPQSAILGMHNIVERPVVVKGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELIE
DPNRILLQV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattaaaagtacctatgttcccagagtctgtagcagatggcacattagctcaa
tggaataaaaacgaaggtgactttgtaaatgagggcgatatcttggcagagattgagact
gataaagttgttctagaagtacctgcaacatctagtggtgttttaaaagggataaaaaaa
catgctggtgatacagtgctttcagaagagtcattagcgatcattgatactgctgcttct
acatctgaacctaaccaacaaactactaatcaaagaaatgcttcagaagcaactgctact
gggcaagaaattgatattaaggcgcctgtattcccagagtctgtagcagatggcacgatc
tcagagtggcataagaaagagggtgaggctgtttctgagggtgatattttagcagagatt
gagactgataaggttgttctagaggttccggcaacatcgaatggtgttttgacaaaaata
ttaaagccagctggagagactgtactatctgcagagcttatcgctaagattacagcagga
ggcgcaactactactacgaaatcagaagcttcggtgggagtttctcaagcaaataatgat
ccgcatctagtaccttcagcacgtaaagcttttaatgcaagcggcttggatactgctgct
aatatcgaaggtacaggtaaaaaaggacgtataacttctgaagatgtcaaaaaagcagtt
acatcagtaaataaacctcaacaacagacagttgttataaatcaaggtgctagatatgaa
aaaagagtcaagatgactcgtctgcgtcagactatagcaaatagattagttgaagttcaa
catactaatgcaatcttaactacttttaatgaagtagatatgagtgcagttatggagctt
agaaacaaatataaagatatgtttgtcaaagaacatgatactaagcttggctttatgtct
ttctttatcaaagcagcaacagaagcacttaagaaattcccagatgtaaatgcctctatt
gatggtgatgagattgtttaccataattattttgatattggtattgctgtaggtactgat
aggggtctagtggtacctgtactaagagatacagatactaaatctctagctgaattagaa
gccgatgttttagacaaagcgattaaaggtcgtgatggtaaactaagccttgaagatatg
caaggtggtacatttacgattacaaatggcggaacttatggttcgatgttatctacgcct
attattaattcaccgcaaagtgctattttaggtatgcataatattgttgagcgtcctgta
gttgttaagggtgagattaagattcgtccaattatgtatttagcgttatcttacgaccat
agaatcattgatggtggtacatctgtaagattcttgaagatgatcaaagagctgattgaa
gatccaaatagaattcttctacaagtatag

DBGET integrated database retrieval system