KEGG   Francisella cf. novicida Fx1: FNFX1_1678Help
Entry
FNFX1_1678        CDS       T01937                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00020  Citrate cycle (TCA cycle)
fcf00190  Oxidative phosphorylation
fcf00650  Butanoate metabolism
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01120  Microbial metabolism in diverse environments
fcf01130  Biosynthesis of antibiotics
fcf01200  Carbon metabolism
Module
fcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fcf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fcf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FNFX1_1678
   00650 Butanoate metabolism
    FNFX1_1678
  Energy metabolism
   00190 Oxidative phosphorylation
    FNFX1_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AEE88063
Position
complement(1755198..1755551)
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTDGMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcttctggaattaaagactttttcgtacaaagagttaca
gctgtgattattgctgtatattttggttatcttatcctagaagctttgtatttgtcgcat
ataggagctcttaactatgatagttggagaggtttgtttaccgatgggatgttttttaga
gttgctacgttaatggcgtacttggcgatgttttttcatgcatgggtgggtatctggatt
atatgtggcgattatattaaatttgcttgggcttctgcgcttgtgatgctgagctttgtt
ttggtatatatattctgctttttttggttatttgcagttttatttttctattaa

DBGET integrated database retrieval system