KEGG   Francisella cf. novicida Fx1: FNFX1_1678Help
Entry
FNFX1_1678        CDS       T01937                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FNFX1_1678
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FNFX1_1678
   00650 Butanoate metabolism
    FNFX1_1678
  Energy metabolism
   00190 Oxidative phosphorylation
    FNFX1_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755198..1755551)
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTDGMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKFAWASALVMLSFVLVYIFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcttctggaattaaagactttttcgtacaaagagttaca
gctgtgattattgctgtatattttggttatcttatcctagaagctttgtatttgtcgcat
ataggagctcttaactatgatagttggagaggtttgtttaccgatgggatgttttttaga
gttgctacgttaatggcgtacttggcgatgttttttcatgcatgggtgggtatctggatt
atatgtggcgattatattaaatttgcttgggcttctgcgcttgtgatgctgagctttgtt
ttggtatatatattctgctttttttggttatttgcagttttatttttctattaa

DBGET integrated database retrieval system