KEGG   Francisella cf. novicida Fx1: FNFX1_1745Help
Entry
FNFX1_1745        CDS       T01937                                 

Definition
hypothetical protein (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fcf  Francisella cf. novicida Fx1
Brite
Enzymes [BR:fcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FNFX1_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1828743..1829363)
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKVMADIPREIFLPRELQTLAYCDTNLVVNERQLR
SPMFTARLIEALAIKVSDNVLKLGLESGYPVALIAKLCKSVELVDYDELGLGVARRQLAS
IGIYNVEFNSAEHITNIIKNGKKYNSIYISEVVTEDEIDESLLGLLETGGRLIFVVRTAI
CDKAYLITKTPKQTYEKSFLFNTYNK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagaaaatatggtaaagcaacaggttcttactgaaggactt
tctttagatggtgttgctaaagttatggcagatattcctagagagatttttttacctaga
gagcttcaaactttagcttattgcgacacaaatttagttgtaaatgaaagacaattaaga
agtccgatgtttacagctaggcttatagaagcattagccatcaaagttagtgataatgtc
ttaaaacttggtttggaaagtggttatccggtagctttaatagccaagttatgtaaaagt
gttgagcttgttgattatgatgagttagggttaggcgtagcaaggcgtcagctagcaagt
attggtatatataatgttgagtttaatagtgctgagcatataactaatattataaaaaat
ggcaaaaaatataattctatctacatatcagaagttgttactgaggatgagattgatgag
tcgttattagggcttcttgagactggcggtagactgatatttgtcgttagaacagctata
tgtgataaagcatacttaataacaaaaactccaaagcaaacatacgaaaagagttttctc
tttaatacatacaataagtaa

DBGET integrated database retrieval system