KEGG   Francisella cf. novicida Fx1: FNFX1_1775Help
Entry
FNFX1_1775        CDS       T01937                                 

Definition
hypothetical protein (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fcf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fcf00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fcf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869062..1870252
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFKELLQEYAGRPTALTK
TRNIVKNTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSANY
SKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNSDGQIEESYSIS
AGLDFPSVGPQHAHLLAIGRAEYASATDDEALDAFKLLCKKEGIIPALESSHALAHALKL
AYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggtggtcaatttgtaccacaaatactt
gtcccagctcttgatcaactcgagcaagaatttataaaagcacaagctgatgaatctttt
aagcaagaatttaaagagcttttgcaagagtatgctggtcgccctactgctcttacaaaa
actagaaatatagtcaaaaacacaaaaaccacgctctacctaaaacgcgaggatctacta
catggtggcgctcacaaaactaaccaagtacttggtcaagctctactagccaagagaatg
ggtaaaaaagagataattgcagaaactggagctggtcagcatggtgttgccactgctttg
gcttgcgcactacttgatctaaaatgcagagtatatatgggtgctaaagatgttgagcgt
caaagtcctaatgtttttagaatgagattaatgggcgccgaagtcatacctgtacatagt
ggctcagctactcttaaagatgcttgtaacgaagcactaagagattggtcagcaaactat
agtaaggctcattacctactaggtactgccgctggacctcatccttttccgacgatagtt
agggaatttcaaagaatgattggtgaagaaaccaaacaacaaatgcttgctaaagaaggt
agactacctgatgctgtgattgcttgtgttggaggtggctcaaatgctatcggtatgttt
gctgactttattgatgaaaaaaatgtcaagcttataggtgtagaacctgctggtaaaggt
attgaaactggtgaacatggagcgcctctcaagcatggtaaaactggtatattttttggt
atgaaggcaccactaatgcaaaactcagacggacaaattgaagagtcatactctatatca
gccggtctggattttccatctgttggacctcagcacgctcatttattagcaataggtcgt
gctgaatatgcatctgctacagatgatgaagcgttagatgcttttaaattactctgtaaa
aaagaaggaattatcccagctctagaatcatctcacgccctagcacacgctcttaaactt
gcttatgaggatcctaataaagagcaacttttggttgttaatctatctgggcgtggtgat
aaggatatttttacagtgcatgatattttaaaagaaaagggagagatttaa

DBGET integrated database retrieval system