KEGG   Francisella cf. novicida Fx1: FNFX1_1776Help
Entry
FNFX1_1776        CDS       T01937                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fcf  Francisella cf. novicida Fx1
Pathway
fcf00260  Glycine, serine and threonine metabolism
fcf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fcf01100  Metabolic pathways
fcf01110  Biosynthesis of secondary metabolites
fcf01130  Biosynthesis of antibiotics
fcf01230  Biosynthesis of amino acids
Module
fcf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fcf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FNFX1_1776
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FNFX1_1776
Enzymes [BR:fcf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FNFX1_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: AEE88161
Structure
PDB: 

Jmol
Position
1870252..1871061
Genome map
AA seq 269 aa AA seqDB search
MTNRYTTLFENLAIKNEGAFIPFVTIGDPNKELSLEIIDTLVSSGADALELGIPFSDPLA
DGPTIQEANIRALESGITPKDCFDVLTKIRAKYPDIPIGLLLYANLVYANGIENFYQKCL
AAGVDSILIADVPAHESKEFRDIAKKVGISQIFIAPPDASESTLKQISELGSGYTYLLSR
VGVTGTETAANMPVEDVLAKLREYNAPKPILGFGISKPEQVQQAIKAGAAGAISGSATVK
IIQNNISNKQKMLNELTYFVKEMKAATLN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatagatacacaaccctttttgaaaatttagcaataaagaacgaaggagctttt
ataccttttgtaacaattggtgacccgaataaagaactatctcttgaaattatcgatact
ctagttagctcaggtgctgatgctcttgagttgggtatacctttttcagatcccttagca
gatgggccaacaattcaagaagcaaatattcgtgctctggagagtggaataacccctaaa
gattgtttcgatgttctaactaaaataagagcaaaataccctgatatccctattggttta
ctactttatgctaatttagtctatgcaaacggtatagagaacttttatcaaaaatgttta
gctgcaggtgttgattctatacttatagctgatgtaccagctcatgaatctaaagagttt
cgtgatattgctaaaaaagttggtatctctcagatattcatcgctcctcctgatgctagt
gagtcaactcttaaacaaatttctgaacttggtagtggttatacgtatttactatcgaga
gttggtgtaacagggacagaaactgctgcaaatatgcccgtagaagatgtgttagctaaa
cttagagaatataatgcacccaagccaatcttaggttttggtatctctaaacctgagcaa
gtacaacaagctatcaaagctggtgctgctggtgcaatttcaggctcagcaacagtgaaa
attattcaaaataatatctctaataaacaaaaaatgcttaatgaacttacatattttgtt
aaagagatgaaagcagctacattaaactaa

DBGET integrated database retrieval system