KEGG   Falco cherrug (Saker falcon): 102046013Help
Entry
102046013         CDS       T02911                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102046013
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102046013
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102046013
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102046013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 499 aa AA seqDB search
MGQTPPATRRHTASLLPDLVLTVDTTQRYQKVKGFGGSVTDAAAMNVFSLPEAAQDHLLR
SYFSEEGLEYNLVRLPMASCDFSLHAYTYDDVPFDYELTHFSLRDEDTKLKIPLLHRALA
MSKQRLSLYASPWTSPAWMKTSESFVGKGTLKGQAGDKYHKTWANYFIRFLDEYAKHNLT
FWAVTAENEPTAGLINNYPFQCLGFTAEQQRDFIARDLGPALANSSHSNIRLIILDDNRL
HLPHWAKVVLEDEEAARYVHGIGIHWYLDFIGPIQDTVVPTHELFPDYFILATEACIGAH
FWERDVILGCWERGNQYSHSILMNLNHFVAGWTDWNLALDLEGGPNWVKNYVDSPVIVDS
SEGIFYKQPMFYHMGHFSKFIPEGSQRVGLVASKESKKTDLEYTAFLRPDGAMVVVVLNR
SPQNITFGLADTVGLIAAMAPASSIQTYLGPGSKSQWPDAESSRDTCPCPCAPLGSEGLI
SSRFSGEGANPPMALGLAH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggccagaccccacctgcgacccgccgtcacaccgcttccctcctgccagatctcgtc
ctgacggtggacacaacgcagcggtaccagaaggtgaagggtttcggcggctctgtcact
gatgctgctgccatgaatgtgttttccctgccagaagcagcccaggatcacctgctgcgc
tcgtacttctcagaggaagggctggagtacaacctcgtccggctccctatggccagctgc
gacttctccctccatgcctacacctacgacgatgttccctttgactatgagctcacccac
ttcagcctgcgagacgaggacacgaagttgaaaatccccctcctgcaccgagccttggcc
atgagcaagcagcggctgtccctgtacgccagcccctggacctccccggcctggatgaag
accagtgagtccttcgtagggaagggcacgctgaaggggcaggcaggggacaagtaccac
aagacctgggccaactacttcatacggttcctggacgaatacgccaagcacaacctgacc
ttctgggcggtgacggcagagaacgagcccacggctgggctcatcaacaactaccccttc
cagtgcctgggcttcacagccgagcagcagcgtgacttcatcgcacgggacctgggccct
gcgctggccaacagctcccacagcaacatccgactcatcatcctggatgacaaccggctc
cacctcccacactgggccaaagtggtcctggaggatgaagaggcagctcgctatgttcat
ggcatcggcatccactggtacctggacttcattggtcccatacaggacacggtggtgccc
actcatgagcttttccccgactacttcatcctggccacggaggcatgcatcggggcccat
ttctgggagagagatgtgatcctgggctgctgggagcgagggaaccagtacagccacagc
atcctgatgaacctgaaccactttgtggctggctggaccgactggaacctggccctggac
ctggaggggggccccaactgggtcaagaactacgtggacagccccgtcatcgtggacagc
agtgaaggcatcttctacaagcagcccatgttctaccacatggggcacttcagtaagttc
atccctgagggctcccagcgtgtggggctggttgcctccaaagagtccaagaagacggac
ctggagtacacggctttcctgcgccccgatggtgccatggtggtggtggttctgaaccgg
tccccacagaacatcaccttcgggctggctgatacggttggcctcattgccgccatggct
ccagccagctccatccagacctacctgggccccggtagtaaaagccagtggccggatgct
gaatcatcccgggacacgtgcccctgtccctgtgctccgcttggctccgaagggctgatt
agctccaggttcagcggagaaggggcaaaccctccgatggcgttgggcttggctcattaa

DBGET integrated database retrieval system