KEGG   Falco cherrug (Saker falcon): 102046273Help
Entry
102046273         CDS       T02911                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102046273 (CHKA)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102046273 (CHKA)
    2.7.1.82  ethanolamine kinase
     102046273 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 387 aa AA seqDB search
MGYHRSGDGADSCVCKTIVKFLFSLSKTLLFGWRGIKKKGFYLSLDRGGLSNMLFQCSLP
DTIETVADEPRKVLLRLYGAILQMRSCNKGESVQSQKENDLQGAEAMVLESVMFAILAER
ALGPKLYGIFPQGRLEEFIPSRKLSTEELSLPDISAEIAEKMARFHGMKMPFNKEPKWLF
GTMEKYLNQVLRIKFTRESRTRKLNKLLSYNLPQEMKNLRAMLEATSSPVVFCHNDCQEG
NVLLLEGRENSENQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFKATALKYP
SKKQQLHFISSYLSAFHDGFAKLSNEEKSKLEEEMLIEVNRFALASHFFWGLWSIIQAKI
SSIEFGYLEYALSRFDAYFDQKKRLKV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggttatcacaggtcgggtgacggggcggatagctgcgtgtgtaaaactatagtgaaa
tttctgttcagcctcagtaagacactgctgtttggctggagaggtataaaaaagaagggt
ttctacctttctcttgatagaggtggcctcagcaacatgctgtttcagtgctcactgcct
gataccattgagacagttgcagatgaaccacggaaagttctcctgcgcttatacggtgca
atcctgcagatgaggtcctgtaacaaaggagagtctgtacagtctcagaaggaaaatgac
ttgcaaggggcagaagccatggttctggaaagtgttatgtttgccattcttgcagagaga
gctcttggcccaaagctgtatggaatctttccacaagggcgactggaggaattcattccc
agcaggaaactaagtactgaagaactaagcttacctgatatatctgctgaaatagctgag
aagatggctagatttcatggcatgaaaatgccatttaataaagaacctaagtggcttttt
ggaacaatggaaaaatatctaaatcaagtgctgaggattaagtttaccagagaatccaga
actagaaaactgaacaaactcctcagttacaatctcccccaggaaatgaaaaatctgaga
gctatgcttgaagctacttcatcaccagttgtattttgccacaatgactgtcaagaaggt
aatgtcttgcttctggaaggcagagagaattcagaaaaccagaagctgatgctcattgac
tttgaatacagcagctataattaccgaggatttgacattggaaatcacttctgtgaatgg
atgtatgattacacgtatgagaagtacccattcttcaaagctactgctcttaaatatcct
tcaaagaagcaacagcttcattttatctccagttacctgtctgcattccatgacggcttt
gcaaagctgagcaatgaagagaagtccaaactagaagaggaaatgttgatagaagttaac
aggtttgcgcttgcatcgcacttcttctggggtctgtggtctattatacaagcaaagatc
tcatctattgagtttggttacctggaatatgcgttatccagatttgatgcgtactttgat
cagaagaagaggctgaaggtgtga

DBGET integrated database retrieval system