KEGG   Falco cherrug (Saker falcon): 102046454Help
Entry
102046454         CDS       T02911                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102046454 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102046454 (LPL)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102046454 (LPL)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102046454 (LPL)
  Exosomal proteins of breast milk
   102046454 (LPL)
Glycosaminoglycan binding proteins [BR:fch00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102046454 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fch00537]
 Enzymes
  102046454 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MAVMEMLRSQMVGAEAETSFEGIESKFSLRTPAEPDEDVCYLVPGQVDSLAQCNFNHTSK
TFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLIRAQQHYPVSAAYTKLVGKD
VAMFIDWMEEQFNYPLNNVHLLGYSLGAHAAGIAGSLTKKKVNRITGLDPAGPTFEYADA
LIRLSPDDADFVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNLGEALRLIAE
KGFADVDQLVKCSHERSIHLFIDSLLYEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLG
YKVNRVRTKRNTKMYLKTRAQMPYKVFHYQVKIHFFGKTNTTKTNQPFLISLYGTLDESE
NIAFTLPEVSSNKTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWSDWWTPFTFDIQRVRVK
SGETQKKVVFCSRDGTSHLSKGEEAAIFVKCLEQPINKKREGAKKASKENSAHESA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatggagatgctgcggtctcagatggtgggagcagaagctgagaccagtttt
gagggaattgagagcaagttctccttacggacgcctgcagagcccgatgaggatgtctgc
tacctggttcctgggcaggtggacagcctggcacagtgcaacttcaaccataccagtaaa
acctttgtggtgatccatgggtggacggtgacaggaatgtatgaaagttgggtcccgaag
ctggtggatgctctgtacaagagagaacccgattcaaacgtcattgtggtggactggcta
attcgagctcagcagcactacccagtgtccgctgcatacactaagctggtgggaaaggat
gttgctatgtttattgactggatggaggagcaattcaattatcctctcaacaatgtccac
ttgctggggtacagtctaggtgcacatgctgctgggattgctgggagcctgaccaagaag
aaggtgaacagaattactgggctggatccagctggtcctacctttgaatatgccgatgcc
ctcatccgcctctcaccagatgatgctgactttgtagatgttctacacacttacactcga
ggctctccagaccgcagcattgggatccagaagcctgttggacacattgatatttatcct
aatggtggaggtttccagccaggttgcaacttaggagaagcactccgtctgatcgctgaa
aaaggctttgcagatgtggaccagctggtaaaatgctcccatgaacgatccatccacctt
ttcattgactccctcctctatgaagaaaagcccagcatggcctaccgctgcaacacaaag
gaggcctttgagaagggtctctgcctcagctgtcggaagaaccgctgcaataatttgggt
tacaaggtcaacagagtgagaacaaagagaaacaccaaaatgtacttgaagacccgtgct
cagatgccttataaagtctttcattaccaggtcaagatccatttctttggaaagactaat
acgaccaagacaaaccagccattcctgatctctctctatggcactctagatgagagtgag
aacattgctttcacactgcctgaagtctcctcaaacaagaccttctccttcctgatttac
acagaggtggacattggtgacctgcttatgctgaaactgcagtgggagaaagacactttc
ttcagctggtcagactggtggactccttttacatttgacatccagagagtcagagtgaaa
tcaggagaaactcagaaaaaggtggtgttctgttctcgagatggaacctcacatctcagt
aagggagaagaagcagcaatattcgtgaaatgcttggagcagcccatcaacaagaagaga
gaaggagccaagaaagcctctaaagaaaattctgctcatgaatctgcttaa

DBGET integrated database retrieval system