KEGG   Falco cherrug (Saker falcon): 102046561Help
Entry
102046561         CDS       T02911                                 

Gene name
PCSK2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102046561 (PCSK2)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S8: subtilisin family
   102046561 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 656 aa AA seqDB search
MERVYDPKEQLWMEPVGPPLAVKQSPAGYSHISDEDRERLIQRTLVSTVPGRLNAQVALG
LESGKRAVSAPAAAAACLPFLDTGYFFYHNGIAKARRRRSLQHKLHLEKDSRVRKAVQQE
GFSRRKRGYRDINDIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVT
IGIMDDGIDYLHPDLASNYNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANN
NICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPR
ELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTAL
YDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANL
DLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTV
PERFHCVGGSIQEPEKIPPSGKLVLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLN
INMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWALEIGFVGSLPQRG
VLKEWTLMLHGTQSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagtttatgatcccaaggaacagctgtggatggaaccagtagggcctccactg
gctgtcaagcagtcgcctgcagggtatagtcacatctcggatgaagacagggagaggcta
atacagagaaccctggtcagtacagttcctggcagacttaatgctcaggtggcactgggc
ttggagagtggaaagcgagctgtgagcgctcctgctgctgctgctgcttgtctccctttt
ttagatactggatacttcttttatcacaatggcattgccaaggccaggagaagacgcagt
cttcaacacaagcttcacctggaaaaggattccagggtacgaaaagctgtgcaacaggaa
ggcttcagcagaaggaagcgaggatacagagacatcaatgacattgacatcaacatgaat
gatcctttatttaccaagcaatggtacctgattaacactggccaagcagatgggactcct
ggacttgaccttaacgtagctgaagcgtgggagctgggatacacagggaagggagtaacc
ataggaattatggatgatggaattgattatctgcatcctgatcttgcatcaaattacaat
gccaaagccagctacgacttcagcagtaatgacccctacccctacccccgctatacagac
gactggtttaacagccatgggacaaggtgtgcgggagaggtgtctgctgcggccaacaac
aacatctgcggcgtgggagttgcgtacaactccaaggtagcaggtattcgaatgctcgac
cagccatttatgacagacattattgaggcttcctctatcagtcatatgcctcaagtcata
gatatatatagtgccagctggggaccaactgataatgggaagacggtggatggacctaga
gagctaacgctgcaagcgatggcagatggtgtgaacaagggccggggtggcaaaggaagc
atctatgtctgggcctctggagatgggggcagctacgatgactgtaattgtgacggttac
gcatcgagcatgtggacaatctccatcaattctgctataaatgatggacggacagctctg
tatgatgaaagctgctcttcaaccttagcctccacctttagtaatgggaggaagagaaat
ccagaggctggtgtggctacaacggatttgtatggaaactgcaccctgcgtcactcagga
acgtctgcagctgcccctgaagcagccggagtgtttgccttggccctggaggctaacttg
gacctgacatggagagacatgcagcatctgacagtgctcacctccaagaggaaccagctt
catgatgaggttcatcagtggcgtagaaatggcgttgggctggaattcaaccatttgttt
ggctatggtgtcctagatgcaggagcaatggttaagatggcaaaagactggaagactgtt
cccgagagattccattgtgttggagggtcaatacaggaacctgaaaagataccaccaagt
ggcaagctggtcctcacgcttacgactgatgcttgtgaggggaaggaaaactttgtccga
taccttgaacacgtccaagcagttataactgtgaattccaccaggcgaggagacctcaac
atcaacatgacctcgccgatgggaacaaagtccattttactgagccggcgccccagggat
gacgactccaaggtgggttttgacaaatggcctttcatgaccacacacacttggggagaa
gacccccgaggcacctgggctctagagattgggtttgtcggcagcctgccacagcggggc
gtgctgaaggagtggacactgatgctgcatgggacccagagcgcaccatatatagaccag
atagtaaaagattatcagtccaaactggccatgtccaagaaggaagagctggaagaagaa
ttagacgaagcagtggagagaagcctgaagagtatactgagcaagaactag

DBGET integrated database retrieval system