KEGG   Falco cherrug (Saker falcon): 102046620Help
Entry
102046620         CDS       T02911                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102046620 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102046620 (COMT)
Enzymes [BR:fch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102046620 (COMT)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102046620 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
MLESFSVLLFVFILLFILLLFLVLIRKNGTAALIWNEIIREKITNFIMNQSKEQRILNFV
LQNAVRGDPCSVLDTIDKYCSQKEWAMNVGDEKGLILDKTLEEVNPSVALELGTYCGYSA
VRIARLLKPGACLLTVEFNPEFAAIAKQMIEFAGVQDKVKLLEGPSEEIIPQLKKKYEVD
TLDFVFLDHWKDRYTPDTILLQECNLLKKGSVLLADNIIVPGAPEFINYIRNNPHFQCTN
YPSHLEYMKVVDAMEKAVFLG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagcttttcagtccttttgttcgtcttcattctgcttttcattttgctgctc
tttctggtgctcatcaggaagaacggcactgctgcccttatctggaatgaaataatccgg
gagaaaataaccaatttcatcatgaatcagagcaaagaacagaggattttaaattttgtg
ctgcagaatgcagtccgaggagatccctgtagtgtgctggacactatagataagtactgc
tcccagaaagaatgggccatgaatgtgggtgatgagaaaggtttaattctagacaagaca
ctggaagaggtcaatccatcagttgcactggagctaggaacatactgtggctactcagca
gttaggattgctcggctactgaagccaggagcttgtcttctcactgtggaattcaaccca
gaatttgctgctatagctaaacagatgattgagtttgctggagtacaagacaaggtaaaa
ctcctagaaggtccttcagaggaaattatcccccagctgaagaaaaaatacgaagtagat
actctggattttgtcttcctggaccactggaaagacagatacacaccagataccatcctg
ctccaggaatgcaacttgctgaagaagggctcggttcttctggctgacaatatcatcgtc
ccaggagctccagaattcattaattatatccgcaacaacccccatttccaatgcactaat
tacccatctcatttggaatatatgaaagtggtggatgctatggaaaaggctgtgtttttg
ggataa

DBGET integrated database retrieval system