KEGG   Falco cherrug (Saker falcon): 102046828Help
Entry
102046828         CDS       T02911                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102046828 (KAT2A)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102046828 (KAT2A)
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102046828 (KAT2A)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102046828 (KAT2A)
   HAT complexes
    PCAF complex
     102046828 (KAT2A)
    STAGA complex
     102046828 (KAT2A)
    TFTC complex
     102046828 (KAT2A)
    SAGA complex
     102046828 (KAT2A)
    SLIK complex
     102046828 (KAT2A)
    ADA-HAT complex
     102046828 (KAT2A)
    HAT-A2 complex
     102046828 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MDLQQPVTNLSEPCRSCSHALADHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTD
TKQVYFYLFKLLRKCILQMSQPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQT
MYELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVNYTRWLCYCHVPQSCDSLPRYET
THVFGRSLLKSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSP
IWEADFTVPAAEGAQLVSRPAAVSTVTVPTTPLFSKKLSNSSSAASMDASTPEPLPGEKR
KLPESLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEE
RRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALI
KDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYA
DEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEI
IKKLIERKQAQIRKVYPGLTCFKEGVRQIPIESVPGIRETGWKPLGKEKGKELKDPDQLY
NTLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFI
ADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEGGLIDK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcagcagccggtgaccaacctgagcgagccctgccggagctgcagccatgcg
ctggcggaccatgtgtcccacctggagaacgtctcggaggaggagatcaaccggttgctg
ggcatggtggtggatgtggaaaacctctttatgtcggtgcacaaggaggaggacacggac
accaagcaggtgtatttctacctgttcaagctcctgcggaagtgcatcctgcagatgagc
cagcctgtggtcgaggggtccctggggagcccccccttcgagaaaccaaacatcgaacag
ggagtcctgaacttcgtccagtacaagttcagccacttgccacccaaggagcggcaaacc
atgtacgagctctccaagatgttcctgctctgcctcaactactggaagctggagacaccg
tcccagttccggcagcgctcgcagaacgatgatgtggccacctacaaggtcaactacaca
aggtggctgtgctactgccatgttccgcagagctgtgacagccttccccgctacgagacc
acccacgtctttgggcgcagcctcctcaagtccatctttacggtcacccgccggcagctg
ctggagaagttccgggtggagaaggacaagctggtgccggagaagcggacactgattctc
acccacttccccaagttcctgtccatgctggaggaggagatctatggcgagaactctccg
atctgggaggctgatttcaccgtgccagccgcagagggtgcccagctggtgtctcgccca
gctgcggtcagcaccgttacagtgcccaccactccactcttcagcaagaagctcagcaac
agcagctctgctgcgagcatggatgccagcaccccagagcccctgccaggggagaagcgg
aagctgcccgagagcctgacactggaagatgccaagcggatccgtgtcatgggagacatc
cccatggagctggtgaacgaggtgatgctgaccatcacggaccctgctgccatgctgggc
cccgagaccagcctgctgtcggcaaacgcggcgcgggatgagacggctcggctggaggag
cgccgcggcatcatcgagttccatgtcatcggcaactcgctctcacagaagtccaacaag
aagatcctgatgtggctggtgggcttgcagaacgtcttctcacaccagctaccacgcatg
cccaaggagtacatcactcgccttgtctttgacccgaagcacaagaccctggcactgatc
aaggacggccgagtgatcggggggatctgcttccgcatgttccccacccagggcttcacg
gagatagtcttctgtgccgtcacatccaacgagcaagtgaagggctacgggacgcacctg
atgaaccacctgaaggagtaccacatcaagcacaacatcctctacttcctcacctatgcg
gatgagtacgccattggctacttcaagaagcagggcttttccaaggacatcaaggtcccc
aagagccgctacctgggctatatcaaggactacgagggggcgaccctgatggagtgtgag
ctgaacccccgcatcccctacactgagctctcccacatcatcaagaagcagaaggagatc
atcaagaagctgatagagaggaagcaagcgcagatccgcaaggtctatcccggcctgacc
tgcttcaaggagggcgtgcggcagatccccatcgagagcgtccccggcatccgagaaacg
ggatggaaaccactggggaaggagaagggaaaagagctgaaggacccggaccagctctac
aacaccctgaagaacctcctggcccagatcaagacccaccccagcgcgtggcccttcatg
gagcctgtgaagaagtcggaggcgccggattactacgaaatcatccgcttccccatcgac
ctgaagaccatgacagagcgcctgaagaaccgctactacgtcaccaagaagctgttcatc
gccgacctgcagcgcatcatcaccaactgccgcgagtacaacccgcctgacagcgactac
tgcaagtgtgccaacaccctggagaagttcttctacttcaagctcaaggagggggggctc
atcgacaagtag

DBGET integrated database retrieval system