KEGG   Falco cherrug (Saker falcon): 102047608Help
Entry
102047608         CDS       T02911                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fch  Falco cherrug (Saker falcon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 661 aa AA seqDB search
MAQQRRVQLSTQRPTSTVCVLGTELSLDVCGSAPKDAVAFHVQGTPGVKLYVVHETQSVK
LPSSVCRWPLAAGAEVLLAMDALSKDVGDEKVRISYFGEAGGVPVGRAMLYLTCVEVSLD
ADTNRSGTVSRTLLDKATWTWGPDGHGAILLVNCDRDDPKAEMPDNRDTAIRSYADLKDM
SQMVLRTRGPRTIFAGHHLLLHVDFSDADKVGVFYGGNSVALEDYKHVLGGSKLAYTVKH
SRHQEESIFYVEGLAFPDVGFSGLVAFHVTLLESPEKGLLETPIFTDTVVFRVAPWIMTP
NTATPLEVFVCSVDDNEDFVAAVGAMAEKAKCPLTVCPLPKNRHDRWIQDEVEFGYVQAP
HKTFPVVFDSPRDRGLKDFPVKSILGPDFGYVARQAPEGASSLDSFGNLEVSPPVTVQGK
EYPLGRILIGSSFPRFGGRRMAKAVKDFLVAQKVQAPVELFSDWLFVGHVDEFLSFVPAP
DRKVTKEAYCHTAPCYQLLKEKQEEGFGEAVMFEGLEDVPKRTINEILANEGLRKFNNYV
QSCINWNRDILKRALGLTEPDILDIPQLFQGDAATGASAYFPDMVNMLVLGRHLGIPKPF
GPLVGGQCCLEERVRALLEPLGLTCTFIDDYYSYHVLSGEVHCGTNVCRKPLAFKWWHMV
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcgccgcgtccagctctccacccagcgtcccaccagcactgtctgcgtg
ctgggcaccgagctctccctggatgtctgtggatctgcacccaaagacgcggttgccttc
cacgtgcaggggacgccgggcgtgaagctctacgtggtacatgagacacagagcgtcaag
ctgccctccagcgtgtgccgctggcccctggccgccggcgccgaggtgctgctggccatg
gatgctctcagcaaggacgtgggcgacgaaaaggtcaggatttcttattttggggaggct
ggcggggtgcccgtgggcagagccatgctgtacctcacctgcgtggaggtctcgctggat
gccgacaccaaccgcagcgggacggtgagcaggacactgctggataaggcaacctggacg
tggggtcccgacggacatggggccatcctgctagtgaactgtgaccgcgacgatcccaaa
gccgagatgccggataaccgtgacaccgccatccgctcctatgccgacctgaaggacatg
tcacagatggtgctgcggacccgaggtccccgcacgatctttgccggccatcacctcctc
ctccacgtagacttcagcgacgctgataaagtcggcgttttctatggcggcaacagcgtg
gcgctggaggattacaagcacgtgctggggggctcgaagctcgcctacaccgtcaaacac
agccggcatcaggaggagagcatcttctacgtggaggggcttgccttccccgacgtcgga
ttttcagggctcgtggctttccacgtcacgctgctggagagccctgagaagggtttgctg
gagactccgattttcactgacacggtggttttccgcgtagctccgtggatcatgactccc
aacacagcaacaccgctggaggtctttgtctgcagtgtggatgacaacgaggattttgtg
gcggccgtgggtgccatggccgagaaagccaagtgccctctcactgtctgtccgctgcca
aagaaccgccatgaccgctggatccaggatgaggtcgaatttggctacgtgcaagccccc
cacaagaccttccccgttgtctttgactcaccccgtgaccggggactgaaggatttcccc
gtcaagagcatcctgggccctgattttggttatgtggcccggcaagcaccggagggtgct
tccagccttgattcttttggtaatttggaggtgagcccccccgtgacggttcagggcaag
gagtatcccttgggccgcatcctgattggcagcagcttcccccggttcggtggccggcgg
atggcaaaagccgtcaaggatttcctcgttgcccaaaaagtgcaggcgccggtggagctg
ttttcggactggctcttcgtcggccacgtagatgagtttcttagcttcgtccctgcacct
gatcggaaggtaacgaaggaagcatactgccatactgcaccctgctaccagctccttaag
gagaagcaagaggaggggtttggcgaggcggtgatgttcgagggactggaggacgtgccc
aagcggacgataaacgagattctggctaacgaaggcctccggaaattcaataattatgtc
cagagctgtatcaactggaaccgggacatcctgaagcgggcgctcgggctgacagagccg
gacatccttgacatcccccagctcttccaaggcgacgcagccactggtgcctcagcctac
ttccccgacatggtgaacatgctggtgctgggcaggcacctgggcatccccaagcccttt
ggaccgctggtgggtgggcaatgctgcttggaggagcgggtgcgggcgctgctggagccc
ctgggcctcacctgcaccttcatcgacgactactactcctaccatgtcctctctggggag
gtccactgcggcaccaacgtctgccgtaagcccctcgccttcaaatggtggcacatggtg
ccctga

DBGET integrated database retrieval system