KEGG   Falco cherrug (Saker falcon): 102048380Help
Entry
102048380         CDS       T02911                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102048380 (DBH)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102048380 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 632 aa AA seqDB search
MGKARRRGAVLPSMQTSRSKPCPCPSFKLREVASMYFTMIAVFLVILVVVLQGSAPRQSD
FAYKVPLDPQGLLELSWNVSYTEQAVHFQLLIKDLQFGLLFGMSDRGEFENADLAVLWSD
GHNSYFGDAWSDATGQIHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYIIEDGTV
HLIYGILAKPVHSLQAINISAIHRGLQRVQLLKPNITIPELPSDMKTMEITAPDIVIPSQ
ETTYWCYMTELPDSFPKHHIIMYEPVITAGNEALVHHMEVFQCAAEFDSFPQYNGPCDSK
MKPNRLNYCRHVLAAWAMGAQAFYYPEEAGLAFGGSGSSRYLRLEIHYHNPMVFKGRHDS
SGIRLYYTATLRRYDAAIMELGLVYTPVMAIPPGEDAFILTGYCTDKCTQMALPTAGIRI
FASQLHTHLAGRKVVTVLSRNGREQQVVNADGHYSPHFQEIRMLKEVVAVFPGDVLTTTC
TYNTEDRSRATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNSFNDEE
VCTCPQVSVPQQFFSIPWNMFNRDVLKSFYSFAPISMHCNKSSAVQFPGEWEKQPLPKIT
ERLQEPVLRCPATPGPQPDAPVPLNLRQLRRD
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagccaggcgcaggggtgccgtcctgcccagcatgcagacctccaggagcaag
ccctgtccctgccccagcttcaagctgcgggaagtggcatccatgtacttcaccatgatc
gctgtgttcctggtcatcttggtggtggtcctgcagggctcggcaccccgccagagtgat
tttgcctacaaagtgcccctcgatccccaggggctgctcgagctctcctggaacgtcagc
tacacggagcaagccgtgcatttccagctcctcatcaaggacctgcagtttgggctcctt
tttgggatgtcggacagaggcgagtttgagaatgcagacctggccgtgctctggagcgac
gggcacaattcctattttggggatgcctggagcgatgccacggggcagatccacatggac
tcgcagcaggactaccagctccttggggctcgaagggctcctgaggggctctacctcctc
ttcagaagagccttcagcacctgtgaccccaaggactacattatagaggatggcaccgtg
caccttatctacgggatcctggcaaaaccggtccattccctccaagccatcaacatctct
gccattcacaggggactgcagagggtgcagctgctaaagcccaacatcaccatccctgag
ctgcccagtgacatgaagaccatggagataacagcccctgacattgtcattcccagccag
gaaacaacctactggtgttacatgacagagctgccagacagcttccccaaacatcatatt
atcatgtatgagccagtgatcacggcaggaaacgaggccctggtccaccacatggaagtc
ttccagtgtgctgctgagttcgacagcttcccccagtacaacgggccctgcgactccaag
atgaagccaaaccggctcaactactgcaggcacgtgcttgcagcgtgggccatgggagcg
caggctttctactaccctgaagaagcaggtctggcctttggtggctcaggctcctccaga
tatttgcgccttgagatccactatcacaatcccatggtgttcaaaggtcgccatgactcc
tcggggatccgcctctactacacggccaccctgcgacgctatgatgctgccatcatggag
ctgggcttggtctacacaccagtgatggccattcccccaggcgaggatgccttcatcctc
acaggctattgcaccgacaaatgcacgcagatggctctgcccactgccggcatccgcatc
ttcgcgtcccagctccatactcacctggcaggaagaaaagtggtgacagtgctgtcccgg
aatggaagagaacagcaggtcgtgaatgccgacggtcactacagccctcacttccaggag
atccgcatgctgaaggaggtggttgcagtttttccaggtgacgtactcaccaccacctgt
acctacaacacagaggaccggagccgagccactgtgggtgggtttggcattctggaggag
atgtgcgtgaactacgtgcactactacccccagacgcagctggagctgtgcaaaagcgcg
gtggatccgggctacctgcaccgatacttcaaccttgtgaacagctttaacgatgaggag
gtctgcacgtgcccacaggtctccgtcccacagcagtttttctccatcccctggaacatg
ttcaacagagacgtgctgaagtccttctacagcttcgctccaatctccatgcactgcaac
aaatcctcagctgtccagttcccgggcgagtgggagaagcagccgcttcccaaaatcacc
gagaggctgcaggagcctgtccttcgctgcccggccaccccggggcctcagcctgacgcc
cctgtccccctcaacctgcgccagctcaggagggactga

DBGET integrated database retrieval system