KEGG   Falco cherrug (Saker falcon): 102048487Help
Entry
102048487         CDS       T02911                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102048487 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1343 aa AA seqDB search
MVKMSGLGENSLDSLTNESRKRKPLPCDTPGASLTCSGEKRRREQESKYIEELAELISAN
LSDIDNFNVKPDKCAILKETVRQIRQIKEQGKAVSNDDDVQKADVSSTGQGVIDKDSLGP
LLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYAILHEEDRKDFLKNLPK
SSVNGVAWTNEAPRQKSHTFNCRMMVKTSHDLLEDVGSHQDIRQRYETMQCFALSQPRAM
MEEGEDLQSCMICVARRITTAERVFPANPESFITRHDLSGKLVNIDTNSLRSSMRPGFED
IIRRCIQRFLCHNDGQSWSNKRHYHEAYTQGHAETPLYRFSLADGTIVTAQTKSKLFRNP
VTNDRHGFVSTHFLQREQNGYRPNPNSVGQNIRTPVAGNTNSVGGLMNMSPGQGMPMQNR
SYGMGDPSAAGQLSSTRYGGPGNMGPVNSGPGMQSSAYQNSSYGLNISSPPHGSPGLTSS
QQNLMISPRNRGSPKMTSHQFSPVTGMHSPMGSASNTSNSTFSSSSLSALQAISEGVGTS
LLSTLSSPGPKLDNSPNMSIAQQSKTSTQDSKSPSGLYCEQNQVESSICQSNSRDPLSEK
DTKEGNLEASESQRGPSETKGHKKLLQLLTCSSDERGHSTASNSPLDSNCKETSTNVTSP
SGVSSSTSGGVSSSSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTYHDASN
TASCGEGTVKQEQLSPKKKENNALLRYLLDKDDVKDPLSKELKPKVESVDNKMGQCSSST
IPTSSQEKEMKIKTEPGEELSGDLDNLDAILGDLTSSEFYNNAMSANGNNLGTKQALFQG
NALLASAPNRNVPMNQHQSGDWGLPNSKVNRLEPTSSASMLRPGAEFSASLPRPAVGSSM
SGLPVRSNSIPGTRPMLQQQMIHMRPNEINIGMGGNPYGQPGPSNQPGSWPDNMLSMEQA
SRGSQNRQLVRNSLDDLLCSAPNMEGQNDERALLDQLHTLLSNTDVTGLEEIDRALGIPD
LVNQGQALEPKQDSFQGQESSVMIDQKPSLYGQPYQGQGAAMPGGFSNVQGQQPSFNSVM
NQMSQQSNFPLQSMHPRANVMRPRTNTPKQLRMQLQQRLQGQQFMNQTRQSLEMKMENPV
SGNTSVMRPVMQPQVGSQQQGFLNAQMVAQRNRELISHHFRQQRMAMMMQQQQQPQAFSP
PPNVTASGSMDSALTGPPMAQVPPQQFPYPPNYGISQQPDTAFSRVSSPPNSMMSSRIGP
SQNPMMQHPQTATMYQSPEMKGWPSGSVARSSSFPQQQFSHQGSPAAYSMMHMNGSSGHI
GQMNINTMPMSGMPMGPDQVSCT
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagatgagtggattaggagaaaactccttggatagcttgaccaatgagtcaagg
aaacgcaagccattgccctgtgatacaccaggtgcaagtctgacctgcagtggtgagaag
cgtcggcgtgagcaggaaagcaaatacattgaagaactggctgaactgatatctgctaat
ctgagtgacattgacaatttcaatgtcaaaccagacaaatgtgctattttaaaagaaact
gtgagacagattcgacagataaaagagcaaggaaaagcagtttctaatgatgatgatgtt
cagaaagctgatgtatcttctacgggtcaaggagttattgataaggattcattgggacct
cttctattacaggcattggacggtttcctgtttgttgtaaatcgagatgggaacatagta
tttgtgtcagaaaatgtcacacagtatctgcaatataaacaagaagacttggttaataca
agtgtctatgctattttgcatgaagaggaccggaaggactttcttaaaaacttacctaaa
tcttcagttaatggagttgcttggaccaatgaagcacctagacagaagagtcatacattc
aattgccggatgatggtgaaaacatctcatgatcttttggaagatgtaggcagccaccag
gatatacgtcaaagatatgaaacaatgcagtgctttgcattatctcagccaagagctatg
atggaagagggggaagatttgcagtcctgtatgatttgtgtggcacgacgtatcacaact
gcagaaagggtatttccagcaaatccagagagctttattacaagacatgatctttcaggc
aaacttgtcaacattgatacaaactcattgcggtcctccatgaggcctggatttgaagat
ataattcgtcgctgtattcagaggtttttatgccacaatgatggacagtcatggtcaaac
aaacgccactatcacgaagcgtatacacaaggtcatgctgaaacaccattgtatcggttt
tctttagcggatggtactatagtgacagcgcaaacaaagagtaaactatttcgaaatcct
gtaactaatgaccgccatggatttgtctctacccactttcttcaaagagaacaaaacgga
tatcggccaaatcctaattcagttgggcaaaacatcagaacacctgtggctggaaacaca
aattctgttggtggtcttatgaacatgtcacctggtcaaggcatgccaatgcagaacagg
agctatggcatgggagatcccagtgcagcgggtcagctcagcagcactcggtatggaggc
cccggtaatatggggccagtgaactccggacccggaatgcagtcctctgcttatcagaac
agcagttatgggttaaacataagtagcccaccacatggtagtcctggtttaacttccagc
caacagaatctaatgatatctcctaggaaccgagggagtccaaaaatgacttcacaccag
ttttctccagttacaggtatgcactctccaatgggatctgccagcaacaccagcaacagc
actttctctagcagttctcttagtgctcttcaagccatcagtgagggtgttggaacttcc
cttttatcaacactttcttcaccgggtccaaaattggataattccccaaacatgagcata
gctcagcaaagtaaaacgagtacccaggactccaaaagcccttctggtttgtattgtgag
caaaaccaagtggaaagttccatttgccagtcaaacagcagggatcctcttagtgagaaa
gatactaaagagggaaatctggaggcatctgaaagtcagagaggaccatctgaaaccaaa
gggcataaaaaactgcttcagctactcacatgctcctcagatgaaagaggacattctaca
gcatcaaactcacctttagactcaaattgtaaagaaacttctaccaacgttaccagccct
tcaggagtttcctcatcaacatctggaggggtatcctcctcctcaaacatgcatggctcg
ctcctgcaagagaagcataggattttacataaattgttgcagaacggtaattctcctgca
gaggtagccaagatcacagctgaagcgactggaaaagacacatatcatgatgctagtaat
acagccagctgtggagaaggcactgtcaaacaggaacaactcagcccaaagaagaaggaa
aacaatgctttactaagatacctcttagataaagatgatgttaaggacccactttccaaa
gagttgaagcctaaagtagaaagtgtggataataaaatgggacaatgcagtagctctaca
attcctacttctagtcaagaaaaagagatgaaaataaaaacggaaccaggagaggagctg
agtggagacttggataatttggatgcaattctaggtgatctgactagttcagagttttac
aataatgctatgtcggcaaacggaaataaccttggcacaaaacaagcattatttcaagga
aatgccctactggcaagtgctcccaacagaaatgtgccgatgaatcagcaccagtcagga
gactggggtctgccaaactcaaaggtgaacaggttggaacctacaagttctgcttcgatg
ttgagaccaggagccgagttcagtgcgtcccttcccaggcccgcggtgggcagctccatg
tctgggctgcccgttcgctccaacagcatacctggtactagaccaatgctacaacagcaa
atgattcacatgaggccaaatgagataaacattggcatgggggggaatccatatggacag
ccaggaccatctaaccaaccaggatcgtggcctgacaacatgctgtccatggagcaagca
tcgcggggctcacaaaacagacaattagttagaaactctttggatgacctcttatgttcg
gcaccaaacatggaaggccagaatgatgaaagggcacttttggatcagctgcacacgctg
ctgagtaatacggatgtcacaggtctggaagaaattgacagagcattaggaattcctgat
cttgtaaaccaaggacaagctttggaacccaaacaagattcatttcaaggtcaggaatct
tcagttatgattgaccagaagccttcattatatggtcagccctatcaagggcaaggggca
gcaatgccaggaggttttagtaacgttcagggacaacagccatcctttaattcagtgatg
aatcagatgagccaacagagcaattttccacttcaaagtatgcatcctagagcaaatgtg
atgagacctcgaaccaatacaccaaagcagctccgcatgcagctccagcagaggcttcag
gggcagcagtttatgaatcagacccgtcagtcgcttgaaatgaagatggaaaatccagtt
agtggtaatacgtcagtgatgagaccagttatgcagccgcaggtgggatcacagcagcaa
ggttttcttaatgctcaaatggtggctcagcgtaacagggagctaataagtcatcatttt
agacaacagaggatggcaatgatgatgcagcagcaacagcaacctcaggccttcagccca
ccaccaaacgtgactgcctcaggaagcatggatagtgctttgacaggccctccaatggct
caagttcctccacagcaattcccctatccaccgaactacggaataagccaacaacctgac
actgcctttagcagagtatcaagccctcccaactcaatgatgtcatcgagaattggaccc
tcccagaatcctatgatgcagcatcctcagacagcaacaatgtaccagtcccccgagatg
aagggctggccgtcgggcagcgtggccaggagcagttctttcccacagcagcagttcagc
catcaaggtagtccggcagcgtacagcatgatgcacatgaatggcagcagtggccatatc
ggacagatgaatattaataccatgcctatgtcagggatgcctatgggtccagaccaggta
agttgtacataa

DBGET integrated database retrieval system