KEGG   Falco cherrug (Saker falcon): 102048535Help
Entry
102048535         CDS       T02911                                 

Gene name
NEU4
Definition
sialidase 4
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102048535 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102048535 (NEU4)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102048535 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 502 aa AA seqDB search
MGSRHFPARTVLFEKEPNGVTYRVPALLYLPCVAKLLAFAEERLSVDDAHANLLVLRRGT
IYGSYVEWEDMRVLETATLQHHRSMNPCPLYDEFTGTLFLFFITVLGRTPEAYQIITGQN
VTRLCCVTSADQGLSWSTAMDLTQQVIGGAIKDWATFALGPGHGIQLRSGRLLVPAYSYH
IDCKECFGQLCKTTPHSFTFYSDDHGQGWRFGEFIPNLQTGECQLVSVDEEDGSNVLYCN
ARSPLGFRVQALSTDDGAVFHGGQLVQRLVEPPHGCHGSVIGFPAPFVYVPAAPQDPMMP
FLGSVHRLLPGMLSELRHLPAQRAAGEELPAAATGSHREPAEPKEGCSTPGHRGHAPAIT
SVQGQPAATPHPAAFFQAPTWVLYSHPTSSISRVNMGVHLSTFPRDVESWTEPWVIYEGP
SAYSDLAYMELPYNEASISGGPAIAFACLYENGTRSPYEQISFSMFTLHDVLQNIPVTAT
VPQRDRSPLRRRKRGRRSCLVS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccggcacttccctgcccgcaccgtgctcttcgagaaggagcccaacggcgtc
acgtaccgtgtgcccgccctgctctacctgccctgcgtggccaagctgctggcatttgcg
gaggagcggctgagcgtcgacgatgcccacgccaacctgctggtgctgcgccgcggcacc
atttatgggagctacgtggagtgggaagacatgcgcgtgctggagacagcgacactgcag
caccaccggtcgatgaacccctgcccgctctatgatgagttcaccggcaccctcttcctt
ttcttcatcacggtgctgggcaggacgcccgaagcctaccagatcatcaccggccaaaat
gtcacccgcctctgctgcgtcaccagtgctgatcagggcctgagctggagcacggccatg
gacctgacgcagcaggtcattggtggggccatcaaagactgggcgacgttcgcgctgggt
cccgggcacgggatccagctgcggtctggccggctgctggtgcccgcctacagctaccac
attgactgcaaggagtgcttcggccagctctgcaagaccacccctcactccttcaccttc
tacagcgacgaccacggccagggctggcgctttggggagttcatccccaacctgcagaca
ggcgagtgccagctggtctcggtggatgaggaggatggctccaacgtcctctactgcaat
gcccgcagccccttgggcttcagggtccaggcgctcagcacagacgatggggccgtcttc
catggggggcagctggtccagcggctggttgagcccccccatggctgtcacggcagcgtc
attggcttccctgcaccttttgtgtacgtccccgctgccccccaggaccccatgatgccc
ttcttgggctcagtgcaccggctgctccctgggatgctctcggagcttcggcacctgccc
gcccagcgggcagcgggtgaggagctgcctgctgcagccaccggcagccaccgtgagcca
gctgagcccaaggagggctgttctaccccagggcatcgtggccatgcccctgccatcacc
tcggtccaagggcagccggcagcaaccccccaccctgctgccttcttccaagcaccaaca
tgggtcctctactcccaccccaccagctccatatcgcgggtcaacatgggagtccacctg
agcaccttccccagggacgtggagagctggactgagccgtgggtcatctacgagggccca
agcgcttactcggacctggcttacatggagctgccctacaatgaggcctccatctctggt
ggcccagccattgctttcgcctgcctttatgagaacgggacacgttcgccgtacgagcag
atctccttcagcatgttcaccctgcacgatgtgctccagaacatccccgtgacagccact
gtcccccagcgggaccgcagccccctgcgccgcaggaagcgggggcgaaggagctgcctc
gtctcctag

DBGET integrated database retrieval system