KEGG   Falco cherrug (Saker falcon): 102048960Help
Entry
102048960         CDS       T02911                                 

Gene name
GAD1
Definition
glutamate decarboxylase 1 (brain, 67kDa)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102048960 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102048960 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102048960 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102048960 (GAD1)
Enzymes [BR:fch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102048960 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 563 aa AA seqDB search
MLGSEKTLTCAPCNNNVGFLQRTNSLEDKGRIVSSLKERQSSKSLLTCENSEKGSRFRRT
ETDFSNLYARDLLPAKNGEEQTMQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGM
EGFNLELSDNPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANT
NMFTYEIAPVFVLMEQITLRKMREIIGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEV
KTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILEA
KQKGYIPLFVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLN
GIERANSVTWNPHKMMGVLLQCSAILVREKGILQGCNQMCAGYLFQQDKQYDVSYDTGDK
AIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYTKIKNREEFEMVFEGEPEHT
NVCFWYIPPSLRGMPDCDERREKLHRVAPKIKALMMESGTTMVGYQPQGDKVNFFRMVIS
NPAATKSDIDFLIEEIERLGQEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagtgagaaaactctgacctgtgcaccttgcaataacaatgtagggttcctg
caaaggaccaacagcctggaagacaagggccggatcgttagctccctgaaggaaaggcag
tcctccaagagcctgctgacatgcgagaacagcgagaagggatccaggttccggcgcacc
gagacagacttctccaatttgtatgccagagatttgctgcccgccaagaatggcgaggag
cagaccatgcagttcctgctggaggtcgtggacatcctcctcaactacgtgaggaagacg
tttgacaggtccaccaaagtgctggacttccaccacccgcaccagctcctggagggcatg
gagggctttaacctggagctctcggacaaccccgagtccctggagcagatcctggtggac
tgtcgggacacactgaaatatggtgtgaggacaggtcatcctcgctttttcaaccagctg
tccacagggctggacatcatcggcctggcgggggagtggctgacatccaccgctaacacc
aacatgtttacctatgaaattgcccctgtttttgtcctcatggaacaaataacacttcga
aagatgagagagattattggatggtcaaataaagatggcgatggaatattctcacccgga
ggagctatctccaacatgtacagcataatggctgcacgctacaagtatttccctgaagtc
aaaaccaaaggcatggctgcagttcctaaactggttctctttacctcggaacatagtcac
tactcaataaagaaagctggagctgcacttggatttggaacagacaatgtgattttgata
aaatgcaatgaaagaggcaagataataccagctgatttggaggcaaaaattttggaagca
aaacaaaagggatatattcctctctttgtaaatgcaactgcaggcacaacagtatatgga
gcctttgatccaatacaggagattgcagatatatgtgaaaaatataacctctggctccat
gtagatgctgcctggggaggtgggctcttaatgtcccgaaagcatcgtcataaattgaat
ggaatagaaagagccaactcagtcacttggaatccacacaagatgatgggagtgttgtta
caatgttctgccattcttgtccgggaaaagggtatactccaaggctgcaatcaaatgtgt
gcaggctatctcttccagcaagacaagcagtatgatgtatcctatgacactggagataag
gcgatacaatgtggtcgacatgtggacattttcaaattctggttgatgtggaaggcaaag
ggtacagtaggatttgaaaatcagatcaacaaatgcctggagctggcggaatatctctac
actaaaataaaaaacagagaagaatttgagatggtttttgaaggggagccagagcataca
aatgtatgtttttggtatattccgccaagtctcaggggcatgccagactgtgatgagaga
agagaaaagttacacagggtggcaccgaaaatcaaagcactgatgatggagtcaggtact
accatggttggatatcagcctcagggcgataaagtcaacttcttccgaatggtcatctca
aacccagcagcaactaaatctgacattgacttcctcattgaggaaatagagagattgggg
caggagctgtag

DBGET integrated database retrieval system