KEGG   Falco cherrug (Saker falcon): 102049197Help
Entry
102049197         CDS       T02911                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00562  Inositol phosphate metabolism
fch04012  ErbB signaling pathway
fch04068  FoxO signaling pathway
fch04070  Phosphatidylinositol signaling system
fch04140  Autophagy - animal
fch04150  mTOR signaling pathway
fch04210  Apoptosis
fch04218  Cellular senescence
fch04370  VEGF signaling pathway
fch04510  Focal adhesion
fch04620  Toll-like receptor signaling pathway
fch04625  C-type lectin receptor signaling pathway
fch04810  Regulation of actin cytoskeleton
fch04910  Insulin signaling pathway
fch04914  Progesterone-mediated oocyte maturation
fch04933  AGE-RAGE signaling pathway in diabetic complications
fch05164  Influenza A
Module
fch_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102049197 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102049197 (PIK3CA)
   04370 VEGF signaling pathway
    102049197 (PIK3CA)
   04068 FoxO signaling pathway
    102049197 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102049197 (PIK3CA)
   04150 mTOR signaling pathway
    102049197 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102049197 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    102049197 (PIK3CA)
   04218 Cellular senescence
    102049197 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102049197 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102049197 (PIK3CA)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102049197 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102049197 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    102049197 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102049197 (PIK3CA)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102049197 (PIK3CA)
  Infectious diseases
   05164 Influenza A
    102049197 (PIK3CA)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102049197 (PIK3CA)
Membrane trafficking [BR:fch04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102049197 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 102049197
NCBI-ProteinID: XP_014137887
Position
Un
AA seq 1073 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDANAPHSRALYVCPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEATAKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMTVIEDHANWTISRELGFNYSYAGLSNRIARDNELRESDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQTSCPQMYCLVKDWPPIKP
EQAMELLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLK
KALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINL
TDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSA
KRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLP
YGCLSIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAID
LFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFV
LTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQS
FDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgcctccacgaccatcatctggtgaactatggggcatccacttgatgccaccgaggatc
cttgttgagtgtcttctcccaaatggaatgatagtgactctagaatgcctccgtgaggcc
accttactaactattaaacatgaactctttaaagaagcaagaaaatatcccctctatcag
ctccttcaagatgaatcttcttacatttttgtaagtgttacacaagaagcagaaagagaa
gaattttttgatgaaacacggagactttgtgacctgcgactatttcagccttttctaaaa
gtcattgaaccagtaggtaacagagaagaaaagatacttaatagagaaataggttttgca
attggcatgcctgtctgtgaatttgacatggttaaggatccagaagtacaagacttcaga
agaaatattctcaatgtttgtaaagaagcagtggatcttcgagatgctaatgcaccacat
agtagagcgttatatgtctgtcctccaaatgttgagtcttcacctgaactacccaaacac
atatacaataagctagataaagggcaaattatagtggtgatatgggtaatagtctcacca
aacaatgataagcagaaatacaccttaaaaatcaatcatgactatgtgcctgagcaagtt
attgctgaagcaattaggaagaaaacacgaagcatgttgttgtcatctgaacaactgaaa
ctttgcgtcttggagtaccagggcaaatacattttgaaagtgtgtggctgtgatgaatac
ttgctagaaaaatacccactgagccagtataagtatataagaagctgtataatgcttggt
cgcatgcccaatctgatgctgatggctaaggaaagcctgtatacccagttgccactggac
acctttacaatgccgtcttactccaggcgtatctctacagctacaccctacatgaatgga
gaagctacagccaaatccctctggactatcaatagtgctctcagaataagaatcctctgt
gcaacctatgtaaatgtgaacattagagacatagacaagatctatgttagaacaggtatc
taccatggaggggaacctttgtgtgacaatgtgaatactcaaagggtaccttgttctaat
cccaggtggaatgaatggctgttgtatgacatgtacattcctgatcttccacgtgctgct
cggctctgcctttccatctgttctgttaaaggccggaagggtgctaaagaggagcactgt
ccattagcttggggaaatataaacatgtttgattatacagacactcttgtatctgggaaa
atggctttgaatctttgggcagtacctcatgggctggaggatttgttgaatcctattggt
gttactggatcaaatccgaataaggaaactccatgtttagagctggaatttgattggttt
agcaatcctgtaaagtttccagatatgacggtgattgaagaccatgccaattggactatc
tcacgtgaactggggtttaactacagctacgcggggctgagtaacagaatagctagagat
aatgaattaagagaaagtgacaaggagcagctgcgagccatatgcacgcgagatcctttg
tctgaaatcactgagcaagagaaggacttcctctggagccacagacactattgcgtgaat
actccggaaattctgcccaaattacttttgtctgttaaatggaattctagagatgaagtg
gcccagacttcttgtccacagatgtactgtttggtaaaagattggcctccgatcaagcca
gagcaagcgatggagcttttggactgtaattatccagatccaatggtgcgagcttttgca
gttcggtgtctagagaagtacttgacagatgacaaactgtctcagtacttaatccagcta
gtacaggttctgaaatatgaacaatatttagataatcagcttgtgagatttttactcaag
aaggcactgaccaatcaaaggataggacacttcttcttttggcatttaaagtctgaaatg
cacaataaaactgtaagtcagaggtttggtttacttctggagtcctattgtcgagcatgt
ggaatgtacctaaagcatctgagcaggcaggtggaggctatggagaagttgattaacctc
acagacattctcaagcaggaaaaaaaagatgagacccagaaggtacagatgaagtttctt
gttgaacaaatgagacggccagattttatggatgctttacaaggttttatctctcctctt
aatcctgcgcatcaactgggaaatcttcggcttgaggagtgcaggataatgtcatctgca
aaaagaccgctgtggttgaactgggaaaacccagatattatgtctgaattgttatttcag
aacaatgagataatctttaaaaatggagatgacttgcgtcaggacatgctgacacttcag
ataattagaattatggaaaacatctggcaaaatcagggtcttgatctaaggatgttgcct
tatggttgtttgtctattggtgactgtgtggggctcattgaggtagtgaggagctctcat
accatcatgcagattcagtgtaaaggaggtttgaaaggagcattgcagttcaacagccat
acattgcatcagtggctcaaggacaagaacaaaggagaaatgtatgatgcagctattgac
ttgtttacacgttcttgtgccggctactgtgttgctacctttattctgggcattggtgat
cgccacaatagtaacatcatggtaaaagatgatggacaactgtttcacattgactttggg
cacttccttgatcacaagaagaagaaatttggttataagagagagcgtgtgccatttgtc
ttaacacaggactttttaatagtgattagtaaaggagcccaagaatgtactaaaacaagg
gagtttgaaaggtttcaggagatgtgttataaggcttacctagcaattcggcagcatgcc
aatctcttcataaatcttttctccatgatgcttggctcaggaatgccagaactgcagtcc
tttgatgatattgcatacattagaaagacccttgcattggacaaaacggagcaggaagct
cttgagtatttcatgaagcaaatgaatgatgctcaccatggtggctggacaacaaaaatg
gactggatcttccacacaataaagcaacatgctttgaactga

DBGET integrated database retrieval system