KEGG   Falco cherrug (Saker falcon): 102049826Help
Entry
102049826         CDS       T02911                                 

Gene name
SCD
Definition
(RefSeq) stearoyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch01040  Biosynthesis of unsaturated fatty acids
fch01212  Fatty acid metabolism
fch03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102049826 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102049826 (SCD)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102049826 (SCD)
Lipid biosynthesis proteins [BR:fch01004]
 Desaturase
  First
   102049826 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102049826
NCBI-ProteinID: XP_005441671
Position
Un
AA seq 310 aa AA seqDB search
MIDDLFDETYQEKEGPKPPVRYVWRNIILMSLLHLGAIFGLMLIPSAKIQTLAWAVLCFL
VSALGITAGSHRLWSHRSYKATLPLRIFLTIANSMAFQNDIYEWVRDHRVHHKFSETDAD
PHNAMRGFFFSHIGWLLVRKHPDVIEKGQKLDLSDIKADKVVMFQRRYYKPSVVLLCFTL
PTVVPWYFWDESIIISFFIPTILRYTIGLNATWLVNSAAHMFGNRPYDQHINPRENPLVS
LGALGEGFHNYHHTFPYDYSTSEFGWRFNVTTAFIDLMCFLGLASDRKKVSKEVILARKM
RTGDGSHKSG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgatctctttgatgagacctaccaggagaaagagggccccaagccccctgtg
cgatacgtctggaggaatatcatccttatgagcctgctgcatctaggggccatattcggg
ttgatgctgataccttctgcaaagatccagacactggcatgggctgttttgtgcttcctg
gtgagcgctctggggataacagctggatctcaccgcctctggagccatcggtcctacaaa
gccacgctgcccctgcggatcttcttgactattgcaaactctatggccttccagaatgac
atctacgagtgggtccgggaccatcgtgtccatcacaagttctccgagacagatgcagac
ccacacaatgccatgcggggcttcttcttctcccacattggctggctgttggtgcgcaag
cacccggatgtcatagagaagggccagaagctggacctgagtgacataaaggccgacaag
gtggtgatgttccagcggagatactacaagccttcggtggtgttgctgtgcttcacgctg
cccactgtagtgccctggtacttctgggatgaatccatcatcatcagcttcttcattcca
accatcctgcgctacaccatagggctcaatgccacttggctagtgaacagtgctgcccac
atgtttggcaaccggccgtatgatcagcacatcaacccccgggagaaccccctggtcagc
ctgggggccctaggagaaggcttccacaactaccaccataccttcccctatgactactcc
accagtgagtttggatggcgcttcaacgtaaccacagccttcattgacctcatgtgcttc
ctggggctggccagcgatcgcaagaaggtctccaaggaagtcatcctggctcggaaaatg
cggactggagatgggagtcacaagagtggctga

DBGET integrated database retrieval system