KEGG   Falco cherrug (Saker falcon): 102050818Help
Entry
102050818         CDS       T02911                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fch00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fch00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 268 aa AA seqDB search
MAAQASLPALIRKKRDGEQLEDEEIQSFVRGVTEGTVQQGQIGAMLMAIRLQGMDAVETL
ALTRAMVASGRVLAWPPAWGGLVVDKHSTGGVGDKVPMISGRGLGHTGGTLDKLEAIPGF
CVSQSPEQMQSILEQVGCCIVGQSKELVPADRELYSLRDVTATVDSLPLITGTGEVAAVG
RCVRDFHPRLLGLTGSPEEVRAASSAYRVYASAGPKDEEGDYIVDHTIFIYLLGPDGLFL
DYYGRNKTDAQIAHSVRRHMESYEPVLE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccaggcctccctcccagccctcatccgcaagaagcgggatggcgagcagctg
gaggatgaggagatccagagctttgtgcgcggtgtgacagagggcaccgtgcagcagggc
cagatcggcgccatgctgatggccatccggctgcagggcatggatgcggtggagacgctg
gcgctgacgcgggccatggtggcctcgggccgggtgctggcctggccccccgcctggggg
gggctggtggtggacaagcactcgacaggtggtgtgggggacaaggtgcccatgatcagt
ggccggggcttgggccacacagggggcacgctggacaagctggaggccatccccggcttc
tgtgtctcccagagccctgagcagatgcagagcatcctggagcaggtgggctgctgcatc
gtggggcagagcaaggagctggtgccagccgaccgggagctatacagcctgcgggacgtc
actgccaccgtggacagcctgcccctcattacaggtacaggggaggtggcagccgtgggg
cgatgcgtgcgggacttccacccgcggctgctgggactgaccggcagccccgaggaggtg
cgggcggccagcagcgcctaccgcgtctacgccagcgccggcccaaaggacgaggagggc
gactacatcgtggaccacaccatcttcatctacctgctgggccctgacgggctcttcctc
gactactacgggcgcaacaagacggatgcacagatcgcccatagcgtccgccggcacatg
gagagctatgagccagtcctggagtga

DBGET integrated database retrieval system