KEGG   Falco cherrug (Saker falcon): 102051070Help
Entry
102051070         CDS       T02911                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102051070 (JOSD2)
Peptidases [BR:fch01002]
 Cysteine Peptidases
  Family C86
   102051070 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
GHTLYVPRGALWGCEDIARMDRAGTLAALKVTMTKAPQSFRLEGWLQERLVAAGGTRTVL
YEGPLRPLCPLAPNNVNTMAAXXXXPHLGFDGIQACLVADPSVPDWHIVEVEVTSVGDKG
RALSVTSIRRNPAAPGAVTGSATRHAFWSSLLAGGPAGLYHERQRLELCAVHALNNVLQR
PCFTQEAADEICKRLAPNAHLNPHRSLLGTGNYDVNVIMAALQSLELAAVWWDKRRSLER
LALGQILGFILNVPSHVSLGFVALPLRRKHWLAVRQLRGTYYNLDSKLRAPVAIGGEAEL
RAFLRDFLSQGLCEVFLVVPRAVEEAGAWLSPE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ggtcacacgctctatgtcccccggggcgccctgtggggctgcgaggacattgcacgcatg
gaccgggctggcacgctggctgcgctgaaggtgacaatgacaaaggccccacagagcttc
cgcctggaggggtggctgcaggagcggctggtggcagcgggggggacacgcactgtcctc
tacgagggtcctctgcgtcccctctgtcccctcgcccccaacaacgtcaacaccatggcg
gccnnnnnnnnnnnnccacacctgggcttcgatggcatccaggcctgcttggtggctgac
cccagtgttcccgactggcacatcgtggaggtggaggtgacaagtgttggggacaaggga
cgggcgctgagtgtcaccagcatccgccgtaatccggcggcacccggtgctgtcactggc
agtgccacccgtcacgccttctggagcagcctgctggcgggggggccggcagggctgtac
catgaacggcagcgcctggagctctgtgctgttcacgcgctcaacaatgtcctgcagcga
ccctgcttcacccaggaggctgcagatgagatctgcaagaggttggcacccaatgcccac
ctcaacccacaccgcagcctcctgggcactggcaactacgacgtcaacgtcatcatggct
gcactgcagagcctggagctggcggccgtttggtgggacaaacgccggtcgctggagcgt
ctggcgctgggtcagatcctgggattcatcctcaacgtcccctctcacgtctcgctgggt
tttgtggcattgccgttacgccgtaagcactggttagccgtccggcaacttcgcggtacc
tactacaacctcgattccaaactccgggcacccgtcgccatcggcggcgaggctgagctg
agggccttcctgcgggatttcctctcccaagggctctgcgaggttttcctagtcgtgccg
cgtgccgtggaggaagccggcgcctggttgagccccgagtga

DBGET integrated database retrieval system