KEGG   Falco cherrug (Saker falcon): 102051400Help
Entry
102051400         CDS       T02911                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102051400 (LYZ)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102051400 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 121 aa AA seqDB search
MESWLVLAFCILSVAALGKVRERCELAAAVKHLGPNNFQGRSLGLCKSRGHMGEQVFVQR
EAPREHAWPQEQESWILQTNSCWWCSGGRTPRAKHMCNIPCSAQLNSYRPRRPADNTVIY
P
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggagtcttggctagtccttgcattttgcatcctatctgtggctgctctggggaaggtc
cgtgagaggtgtgagctggcagcagctgtgaagcatcttggaccaaataactttcaggga
cgcagcctgggactctgcaagtccagggggcacatgggtgagcaggtatttgtgcagcga
gaagctccacgggagcatgcttggccacaggagcaagaatcgtggatcttacagaccaac
agctgctggtggtgcagtggtggcaggaccccgagggccaagcacatgtgcaatatcccc
tgctcagcacaactgaacagctatcgaccaagaagaccagctgacaacacagttatttac
ccatga

DBGET integrated database retrieval system