KEGG   Falco cherrug (Saker falcon): 102052253Help
Entry
102052253         CDS       T02911                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102052253 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102052253 (GBA2)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102052253 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 799 aa AA seqDB search
MQPKRYFRWWYKKTRIEKKSAFIDLLCAVPLQQIYGCPLGGIGGGTITRGWRGDFCRWQL
NPGIYHYETVIANQFTVCLRCKGQTVYQQVLSVERPSTLQGWNWGYCGRYAFYHALYPRA
WMVYELPGQNVVLTCRQVSPVIPHDYKDSSLPVGVFIWEVENGRNEDVEVSIMFSLQNGT
GTKEDRSGGHWNEPFAFEKEGERVAGVLLHHCTHVNPFTLAISAREKADTGITHLTAFNP
VASGREVWQDLLQDGRLDSPAGKSSVTEKGEVTAAAVCASCRVPAQGHRTLELALAWDMP
CVHFGSREKLHLRRYTRFFGSRGDAAPALSHHALTHYEEWERKIEAWQKPILENSQLPSW
YKSALFNELYFMTDGGTIWVELPPDCCAKDLQGPAGAGLSHLLPVLREYGRFAYLEGQEY
RMYNTYDVHFYASFALVMLWPKLQISLQYDIAVTVVNEDIQPRQYLMCGQTAQVKLKNVV
PHDIGDPGDEPWQRVNAYLMHDTANWKDLNLKFVLQVYRDYYLTHDSLYLQDMWPVCQAV
MESELKFDTDNDGLIENGGFADQTYDAWVVNGASAYCGGLWLAAVCMMCKMAKVLGDAEI
QQKYTDILSKGKEAFERMLWNGKYYNYDSSGSDTSSSIMSDQCAGQWFLGACGLDQGEFE
VFPRSHVISALKTIFEKNVMSFAGGTMGAVNGMRPDGVPDTSSVQSDEVWIGVVYALAAT
MIQEGLVEEGFRTAEGCYRTVWERLGMAFQTPEAYREKKVYRSLAYMRPLSIWSMQLALE
RRAGWAPAPVQRPQVPIHP
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaaaaagatacttcaggtggtggtacaagaagacacgcatagagaagaaatct
gcctttattgacctcttgtgtgctgttcctctgcagcagatctatgggtgcccgctgggc
gggatcgggggaggcaccatcacccgtggctggcggggcgacttctgccgctggcagctg
aaccctggcatttatcactatgaaacggtcatcgccaaccagttcacggtgtgcttgcgt
tgcaaagggcagacggtttaccagcaggtcttgtctgtggagagacccagcaccctgcag
ggctggaactggggctactgtggccgctatgccttctaccatgccctctacccccgtgcg
tggatggtctatgagcttccggggcagaatgtggtgcttacttgccgccaggtctctcct
gtcatcccccacgactataaggactccagcctgccggtgggagtgttcatctgggaggtg
gagaatgggaggaatgaggatgtggaagtctccatcatgttcagcctgcagaatggcacg
ggaacaaaggaggacaggagcggagggcactggaacgagccttttgccttcgagaaggag
ggcgagcgggttgcaggagtcctgctgcaccattgcacacatgtgaaccccttcaccctc
gccatttctgccagggagaaggctgacacgggaatcacccacctcacagcatttaatcct
gtggcatcgggtagagaggtgtggcaggacctcctgcaggatggcaggctggattcacct
gccggtaaaagtagcgtgacagagaagggggaggtgacagcagcagcagtgtgtgccagc
tgcagggtgcctgcccaggggcacaggactctggagctggccctggcttgggacatgccc
tgtgttcactttggctccagggagaagctgcatctcaggcggtacacccgtttctttggc
agcagaggtgatgctgctcctgccctgtcgcatcatgccctgacacactatgaggagtgg
gagaggaagatcgaggcatggcagaagcccatcctggagaacagccagctgccttcctgg
tacaagtcagcactcttcaatgagctgtacttcatgacggacggggggaccatctgggtg
gagctgcccccagactgctgtgccaaggacctgcaggggccggcgggggctggcctctcc
cacctgctccctgtcctgcgggagtatggaaggtttgcttatttggaaggccaggagtac
cggatgtacaacacctatgatgtccacttctacgcctcctttgctcttgtcatgctgtgg
cccaagctgcagatcagcctgcagtatgacattgctgtcacagtggtgaatgaggacatc
cagccccggcagtacttgatgtgtggtcagacagcccaggtgaagctgaaaaatgtggtg
ccgcatgacattggggacccaggtgatgagccgtggcagcgtgtcaatgcctatctgatg
catgacactgccaactggaaggacctcaacctgaagtttgtgctgcaggtgtaccgtgac
tactacctgacacatgactccttgtacttgcaggacatgtggccagtctgccaggctgtg
atggagtcagagctgaagtttgacacagataatgatgggctcatcgaaaacggtggcttt
gctgaccagacatatgacgcttgggtggtaaatggagccagcgcctactgcggtgggctg
tggctggcagctgtctgcatgatgtgcaagatggcaaaggtgcttggggatgctgagatc
cagcagaaatacacagacatcctgtccaagggcaaggaagcatttgagaggatgctctgg
aatgggaaatactacaactatgacagcagtgggagtgacacttccagcagcatcatgtca
gaccagtgtgctgggcagtggtttcttggtgcttgtggcctggaccaaggggagtttgag
gtcttccccaggagtcatgtcatcagtgcactgaagaccatctttgagaagaatgtcatg
agctttgctggtggcaccatgggagcagtgaatggcatgagacctgacggggtgcctgac
acctctagcgtgcagtctgacgaggtgtggattggtgtggtctacgccttggctgccacc
atgatccaggaggggctggtggaggaaggctttcgtacagcagagggctgttaccggaca
gtttgggagcggctggggatggctttccagacaccagaggcctatcgggagaagaaagtc
taccgctcgctggcttacatgcgaccgcttagcatctggagcatgcagctggccctggag
cgcagagctggctgggcaccagcacctgtgcagcgcccccaggtccccatccacccttga

DBGET integrated database retrieval system