KEGG   Falco cherrug (Saker falcon): 102052371Help
Entry
102052371         CDS       T02911                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    102052371 (POMT2)
   00514 Other types of O-glycan biosynthesis
    102052371 (POMT2)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102052371 (POMT2)
Glycosyltransferases [BR:fch01003]
 O-Glycan biosynthesis
  O-linked Man type
   102052371 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 688 aa AA seqDB search
MKNMSKKTFLEFFYCLQHYSSWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSG
YDGTFPFQKPGDRYEQHNYVGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFILIF
DTGCITLSQYILLDPILMFFLMGAVLSMVKCNGCANRPFSASWWFWLSLTGVNLAGAMGV
KFVGLFVVLLVGLNTIYDLWDLLGNLSLSLVMFGKHLLARVLCLILLPLALYTAMFAVHF
TVLNKSGPGDGFFSSAFQSQLIGNNLHNVSVPEHLAYGSVVTMKNLRMAGGYLHSHWHLY
PEGIGARQQQVTAYLHKDLNNLWIIKKPDLDTDLSDPSSPVEFVRHGDIIRLEHKETSRN
LHSHQHEAPLTRKHFQVTGYGINGTGDSNDFWRIEVVGRKAGKLIKVLRSQVRLIHVATG
CILGSSGKTLPKWGWEQVEVTCTPYLKETPNSLWNFEDHINPKLPNISLDVLKPSFAEIL
LESHMVMIRVNLSLKPKDNEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNL
VTIGLYLLITVSTAVALKRGVQLTSELKELSRVMLHGGGQIALGWLLHYLPFFMMGRVLY
FHHYFPAMLFSSMLTGITWDALLKFCAGFLLPSTTARKVYGGGFLALVLLIMYSFYLFHP
LSYGMIGPMASDPSSPMAGLRWMDSWEF
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatgagtaaaaagaccttcctggagtttttttactgtcttcagcattatagc
agttgggatgaaactcattttgggaagatgggcagttactacattaatcggaccttcttc
tttgatgtccacccccctctggggaagatgctgattggacttgctggctaccttagtgga
tatgatggcacatttcctttccaaaagccaggagacagatatgagcagcacaactacgtg
ggaatgagagggttctgtgcgttccttggttcctgcctggttcccttcgcctacctcaca
gtgctggaactgtcaaagtcactgccagcagcattactcacagctttcatccttattttt
gatacaggatgtattactttgtcccaatatattctactggatcccattctcatgttcttc
ctcatgggagctgttctgagtatggtgaaatgcaacggctgtgcgaataggccattttct
gcttcctggtggttctggctgagtctgactggcgtgaaccttgctggggcaatgggcgta
aagtttgttggcctttttgtagtcctcttggttggcctgaacacaatctatgacctatgg
gacttgctggggaacctcagcctgtcactggtcatgtttgggaagcatttactggctcgt
gtactctgcctcatcctgctcccgcttgccctctacacggctatgtttgctgttcatttt
acagtattaaataaaagtggtcctggggatggtttcttcagctcagcatttcagtcccag
ctgattgggaacaatcttcataatgtctctgttccagagcacttggcgtatgggtctgtt
gtcacaatgaagaaccttcggatggcaggaggataccttcactcccactggcacctctac
ccggagggcattggggctcgccagcagcaggtcactgcctacttgcataaagatttgaat
aacctgtggattataaagaaacctgatttggatacagatctgtcagacccctcgagccct
gtggaatttgtgagacacggagatattattcgtctggagcataaagaaacttctagaaat
cttcacagtcaccagcatgaggctcccctgacgaggaagcatttccaggtcactggctat
ggaataaatggaacaggagactccaatgacttctggcggatcgaagtggtaggcagaaag
gctgggaagctcatcaaagtcctacggagtcaggtccggctaatccatgtggccacaggg
tgtatactgggctcttctggaaagactctgccaaaatggggttgggaacaagtggaagtc
acctgcacaccatacctgaaggagacccccaattccctctggaactttgaagatcacatt
aaccctaagttgcccaatatcagcctggatgttttaaaaccctcttttgcagaaattctg
ctagaatcccacatggttatgattcgggtaaacttgtctctcaaaccaaaggacaatgaa
gttacatccaaaccttggcactggcccatcaactaccagggcctgcgtttttctggtgtc
aatgagactgattatcgggtttatttgctggggaacccggtgatttggtggctaaatctg
gtcactattgggttatatcttctgataacagtttccactgcagtggccctgaagagaggt
gtccaactgacatctgaactcaaagaactgtccagagtcatgctacatggtggagggcag
atcgcgctgggctggctccttcattacctccctttttttatgatgggacgagttctctac
tttcaccactactttcctgccatgcttttttccagcatgttgacaggaatcacctgggac
gctctactgaagttctgtgctggattcctgttacctagcactacagctagaaaagtgtat
ggaggggggttcctggcactggttctgctcatcatgtacagcttctacctcttccatcct
ctgtcctacgggatgataggacccatggcctctgaccctagcagccccatggcagggctc
cggtggatggactcctgggagttctag

DBGET integrated database retrieval system