KEGG   Falco cherrug (Saker falcon): 102053039Help
Entry
102053039         CDS       T02911                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102053039
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102053039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 219 aa AA seqDB search
NWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRV
MSSFRWPRNFVNGRDVNDWVGPPSNADGSVRPVTINADTTCGNDWVCEHRWRQIKNMVIF
RNVVDGQPFSNWWDNGSNQVAFGRGSKGFIVFNNDDWDLNISLQTGLPAGTYCDVISGEK
EGNTCTGEQVYVSGDGIARFHVSNNAEDPFVAIHVNAKL
NT seq 661 nt NT seq  +upstreamnt  +downstreamnt
gaactggggagaaggctggggctttgtgccttccgacagagccctggtctttgtggataa
tcacgacaaccagcggggccacggggctggtggagcttccattctaacgttctgggacgc
caggctttataagatggcagttggtttcatgcttgctcatccatatgggttcacgcgtgt
gatgtcaagttttcgctggccaagaaactttgtcaatggacgggacgtcaatgactgggt
tggaccgccgagtaacgcggatggatcagtaaggcccgttacaatcaatgcagacactac
ctgtggcaacgactgggtttgtgaacatcgctggcgtcaaataaagaacatggtcatctt
ccgtaatgtggtggacggtcagcctttctccaactggtgggacaacggcagcaatcaagt
ggcttttggtcgtggtagtaaaggcttcatcgttttcaataatgacgactgggatctgaa
catcagtttgcaaacgggactgcctgctggtacctactgtgatgttatttctggagaaaa
ggaaggcaacacatgtactggagaacaggtctatgtttccggagacgggatagctcgttt
ccacgttagtaacaacgctgaagatccatttgttgcaattcatgttaatgctaagttata
a

DBGET integrated database retrieval system